Chicken Whole Blood
Kingfisher Biotech Inc Rabbit CTLA-4 Recombinant Protein
The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124)) (Gene ID: 100009412). For research use only. Made in the USA
Kingfisher Biotech Inc Cynomolgus Monkey IL-16 Recombinant Protein
The Cynomolgus Monkey IL-16 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey IL-16 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey IL-16 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey IL-16 Specifications: (Molecular Weight: 13.4 kDa) (Amino Acid Sequence: PDLNSTTDSA ASASAASDVS VESSAEATVY TVTLEKMSAG LGFSLEGGKG SLHGDKPLTI NRIFKGAASE QSETIQPGDE ILQLAGTAMQ GLTRFEAWNI IKALPDGPVT TVIRRKSLQP KETTAAADS (129)) (Gene ID: 574100). For research use only. Made in the USA
Kingfisher Biotech Inc Atlantic Salmon CCL28 Recombinant Protein
The Atlantic Salmon CCL28 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Atlantic Salmon CCL28 applications are for cell culture, ELISA standard, and Western Blot Control. Atlantic Salmon CCL28 yeast-derived recombinant protein can be purchased in multiple sizes. Atlantic Salmon CCL28 Specifications: (Molecular Weight: 8.1 kDa) (Amino Acid Sequence: GIPKCCVTTS MNIPTNVLRK VERAEMQRSN GVCDINALVL HVKGKKLCTH PKVKRKLKRM QRKKDGKPKR N (71)) (Gene ID: 100196449). For research use only. Made in the USA
Kingfisher Biotech Inc Equine CXCL7 Recombinant Protein
The Equine CXCL7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL7 applications are for cell culture, ELISA standard, and Western Blot Control. Equine CXCL7 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL7 Specifications: (Molecular Weight: 11.2 kDa) (Amino Acid Sequence: TITIGEISTL AKSVDDELYA ELRCLCVKTT SGIHPRIIQT LQVIRAGPHC SKVEVIATLK NGKEICLDPG AVRIKNIVQK ILESDGSAAS SVHILSNLSD SQEE (104)) (Gene ID: 103566766). For research use only. Made in the USA
Kingfisher Biotech Inc Dolphin CCL17 Recombinant Protein
The Dolphin CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Dolphin CCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Dolphin CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Dolphin CCL17 Specifications: (Molecular Weight: 9.1 kDa) (Amino Acid Sequence: ARATNVGWEC CWEYFKGAIP FRKLVRWYRT PEDCPRDAIV LVTLHGRSIC SDPKDRWVKK AVKYLQNTTK SCDLAAQPA (79)) (Gene ID: 101325821). For research use only. Made in the USA
Kingfisher Biotech Inc Dolphin CCL22 Recombinant Protein
The Dolphin CCL22 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Dolphin CCL22 applications are for cell culture, ELISA standard, and Western Blot Control. Dolphin CCL22 yeast-derived recombinant protein can be purchased in multiple sizes. Dolphin CCL22 Specifications: (Molecular Weight: 8.5 kDa) (Amino Acid Sequence: TEAGPYGANV EDSICCRDYI RHPLPLRLVK YYYWTSESCR RPGVVLLTVR DREICADPRL PWVKKILQRL DQ (72)) (Gene ID: 101323189). For research use only. Made in the USA
Kingfisher Biotech Inc Cynomolgus Monkey CXCL1 Recombinant Protein
The Cynomolgus Monkey CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CXCL1 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: ASVVTELRCQ CLQTLQGIHP KNIQSVNVKA PGPHCAETEV IATLKNGQKA CLNPASPMVQ KIIKKMLNCD KSN (73)) (Gene ID: 574222). For research use only. Made in the USA
Kingfisher Biotech Inc Bat IL-4 Recombinant Protein
The Jamaican fruit-eating Bat IL-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Jamaican fruit-eating Bat IL-4 applications are for cell culture, ELISA standard, and Western Blot Control. Jamaican fruit-eating Bat IL-4 yeast-derived recombinant protein can be purchased in multiple sizes. Jamaican fruit-eating Bat IL-4 Specifications: (Molecular Weight: 12.8 kDa) (Amino Acid Sequence: RKPNLTLEET IKTLNILTAR KDPRCMELPV ADVLAAPKNT TERETFCRAA TALRQLYRHH ECASRRFLSR LDRSLSGLAG QNTCATDGVR KSALKDFLER LRRIMQEKYA RG (112)) (Gene ID: 119037707). For research use only. Made in the USA
Kingfisher Biotech Inc Ferret IL-22 Recombinant Protein
The Ferret IL-22 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IL-22 applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IL-22 yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IL-22 Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: EAVPIGSHCR LANSDFEQPY ITNRTFMLAG EASLADNNTD VRLIGDTLFH GVNKEDHCYL MKEVLNFTLE EVLLPQSHRF QPYMQEVESF LTKLSNRLSQ CHIDSDDQHI QRNVQNLKDT VKKLGEDGEI KAIGELNLLF IALRDACI (148)) (Gene ID: 101693444). For research use only. Made in the USA
Kingfisher Biotech Inc Ferret CCL21 Recombinant Protein
The Ferret CCL21 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret CCL21 applications are for cell culture, ELISA standard, and Western Blot Control. Ferret CCL21 yeast-derived recombinant protein can be purchased in multiple sizes. Ferret CCL21 Specifications: (Molecular Weight: 12.3 kDa) (Amino Acid Sequence: GAQDCCLKYS LRKIPARVVR SYRKQEPSLG CPIPAILLSP RKRSQPELCA DPKEPWVQQL MQRLDQPPAP QKQVQGCKKD KGTPKSGKKG KGSKGCKRTK PPQTPERSTA Q (111)) (Gene ID: 101687487). For research use only. Made in the USA
Kingfisher Biotech Inc Squirrel Monkey IFN beta Recombinant Protein
The Squirrel Monkey IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Squirrel Monkey IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Squirrel Monkey IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Squirrel Monkey IFN beta Specifications: (Molecular Weight: 20.0 kDa) (Amino Acid Sequence: MSYNLLGFLQ RRSNFQSQKL LRQLNGRLEY CLKDRMDFEI PKEITQPQRL QKEDVALIVY EMLQNIFTIF NRDFSRTGWN KTIVENFLAN VYQHIEHLKT ILKEKWEKKE FTREKSMSSL HLKRYYGRIL HYLMAKEYSH CAWTIVSAEI LRNFYFIDRL TGYL (164)) (Gene ID: 101035681). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine Regakine-1 Recombinant Protein
The Bovine Regakine-1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine Regakine-1 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine Regakine-1 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine Regakine-1 Specifications: (Molecular Weight: 8.3 kDa) (Amino Acid Sequence: EANEEPAGNM RVCCFSSVTR KIPLSLVKNY ERTGDKCPQE AVIFQTRSGR SICANPGQAW VQKYIEYLDQ MSK (73)) (Gene ID: 504773). For research use only. Made in the USA
Kingfisher Biotech Inc Ferret IFN Beta Recombinant Protein
The Ferret IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN beta Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: AMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFKIPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLEEILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKLTDSLPN (166)) (Gene ID: 101679100). For research use only. Made in the USA
Kingfisher Biotech Inc Ferret IFN Lambda 3 Recombinant Protein
The Ferret IFN lambda 3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN lambda 3 applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN lambda 3 yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN lambda 3 Specifications: (Molecular Weight: 19.4 kDa) (Amino Acid Sequence: VPGPKPLKVF PDAGGCHLAQ FQSLSPQELQ AFKKAKDTFE ESLSLKAWSC RPRLFPRTWD LQQLQVGERP VALEAEVALT LKVLETMADR SLGSILDQPL HTLRHIQSEL QACVEAQPLA GPRPRGRLHH WLHRLHEAPK KEPLGCLENS VMFNLFRLLT RDLKCVASGD LCA (173)) (Gene ID: 101672127). For research use only. Made in the USA
Kingfisher Biotech Inc Rat EPO Recombinant Protein
The Rat Erythropoietin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat Erythropoietin applications are for cell culture, ELISA standard, and Western Blot Control. Rat Erythropoietin yeast-derived recombinant protein can be purchased in multiple sizes. Rat Erythropoietin Specifications: (Molecular Weight: 18.5 kDa) (Amino Acid Sequence: APPRLICDSR VLERYILEAK EAENVTMGCA EGPRLSENIT VPDTKVNFYA WKRMKVEEQA VEVWQGLSLL SEAILQAQAL QANSSQPPES LQLHIDKAIS GLRSLTSLLR VLGAQKELMS PPDATQAAPL RTLTADTFCK LFRVYSNFLR GKLKLYTGEA CRRGDR (166)) (Gene ID: 24335). For research use only. Made in the USA