Antibodies
Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies
(1,884,029)
Secondary Antibodies
(73,276)
Isotype Controls and Standards
(12,584)
Antibody Panels and Kits
(1,390)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
1
–
15
of
1,891,774
results
Invitrogen™ CDH17 VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA1325)
Alpaca Recombinant Monoclonal Antibody
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Western Blot |
| Form | Liquid |
| Gene Accession No. | Q12864 |
| Isotype | VHH |
| Concentration | 1.25 mg/mL |
| Antigen | CDH17 VHH-8His-Cys-tag |
| Gene Symbols | Cdh17 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | BILL-cadherin; Cadherin; cadherin 17; cadherin 17, LI cadherin (liver-intestine); cadherin-16; cadherin-17; CDH16; CDH17; FLJ26931; HPT1; HPT-1; HPT-1 cadherin; HPT-1/LI; human intestinal peptide-associated transporter HPT-1; human peptide transporter 1; intestinal peptide-associated transporter HPT-1; LI cadherin; LI-cadherin; Liver-intestine cadherin; MGC138218; MGC142024; P130 |
| Gene | Cdh17 |
| Product Type | Antibody |
| Gene ID (Entrez) | 1015 |
| Formulation | 16.7mM citrate, 0.94mM citric acid with 6.2% sucrose and no preservative; pH 6 |
| Immunogen | Recombinant Human CDH17/Cadherin-17. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA1325 |
Invitrogen™ beta Actin Loading Control Monoclonal Antibody (BA3R)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat,Rabbit,Chicken |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P29751, P60706, P60709, P60710, P60711 |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | beta Actin Loading Control |
| Gene Symbols | ACTB |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 0610041G09Rik; AA959943; AAT6; ACT; Act4; Act-4; ACT-5; ACTA; acta1; acta1b; ACTA2; Acta-2; ACTA3; actb; actb.L; actb1; actba; ACTC; actc1; Actc-1; actc1b; ACTE; Actg; ACTG1; Actg2; ACTGE; actin; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 1, skeletal muscle b; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin alpha cardiac muscle 1b; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin, alpha 1, skeletal muscle; actin, alpha 1b, skeletal muscle; actin, alpha 2, smooth muscle, aorta; Actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; actin, alpha cardiac muscle 1b; actin, alpha skeletal muscle; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta 1; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; actin, gamma 1; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha actin 1; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-smooth muscle actin; ASD5; ASMA; a-SMA; Bact; Bact; actin; B-actin; bactin1; bactin1 protein; bactzf; B-ACTZF; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin-1; BRWS1; BRWS2; cardiac muscle alpha actin 1; cardiofunk; cell growth-inhibiting gene 46 protein; Cfk; CFTD; CFTD1; CFTDM; CMD1R; CMH11; cytoplasmic 1; cytoplasmic beta-actin; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; E430023M04Rik; E51; epididymis luminal protein 176; fa27h01; fb83f06; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hm:zeh0631; I79_002310; I79_013242; I79_019066; LVNC4; MPFD; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; PS1TP5-binding protein 1; PS1TP5BP1; SHPM; similar to beta actin; skeletal alpha actin; skeletal alpha1 actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; vascular smooth muscle alpha-actin; VSCM; wu:fa27h01; wu:fb63d03; wu:fb83f06; wu:fd18f05; XELAEV_18045052mg; zeh0631 |
| Gene | ACTB |
| Product Type | Antibody |
| Gene ID (Entrez) | 100009272, 11461, 396526, 60, 81822 |
| Formulation | PBS with no preservative; pH 7.2 |
| Immunogen | Beta-actin N-terminal peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | BA3R |
Human PDX-1/IPF1 Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody has been used in 27 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human,Mouse,Pig,Rat,Xenograft |
| Host Species | Goat |
| Conjugate | Unconjugated |
| Applications | Dual RNAScope ISH-IHC,Flow Cytometry,Immunocytochemistry,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Mass Cytometry,Simple Western,Western Blot |
| Isotype | IgG |
| Gene Accession No. | P52945 |
| Concentration | LYOPH |
| Antigen | PDX-1/IPF1 |
| Gene Symbols | PDX1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 1 ug/mL, Simple Western 10 ug/mL, Immunohistochemistry 5-15 ug/mL, Immunocytochemistry 5-15 ug/mL |
| Gene Alias | Glucose-sensitive factor, IDX1, IDX-1GSF, Insulin promoter factor 1, insulin promoter factor 1, homeodomain transcription factor, Insulin upstream factor 1, IPF1, IPF1pancreas/duodenum homeobox protein 1, Islet/duodenum homeobox-1, MODY4IUF1, pancreatic and duodenal homeobox 1, pancreatic-duodenal homeobox factor 1, PDX-1IPF-1, somatostatin transcription factor 1, Somatostatin-transactivating factor 1, STF-1IUF-1 |
| Gene ID (Entrez) | 3651 |
| Immunogen | E. coli-derived recombinant human PDX-1/IPF1 Ala91-Arg283 Accession # P52945 |
| Classification | Polyclonal |
| Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human PDX-1/IPF1 in direct ELISAs and Western blots. In direct ELISAs, approximately 45% cross-reactivity with recombinant mouse PDX-1 is observed. |
Promotions Available
Human/Mouse TREM2 APC-conjugated Antibody, R&D Systems™
Human/Mouse TREM2 APC-conjugated Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody has been used in 5 publications
| Content And Storage | Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 degreesC as supplied. |
|---|---|
| Target Species | Human,Mouse,Transgenic Mouse |
| Host Species | Rat |
| Conjugate | APC |
| Applications | Flow Cytometry,Immunocytochemistry,Neutralization |
| Form | Purified |
| Isotype | IgG2b |
| Gene Accession No. | Q99NH8 |
| Antigen | TREM2 |
| Gene Symbols | TREM2 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Flow Cytometry 10 uL/10^6 cells |
| Gene Alias | PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c, TREM-2triggering receptor expressed on myeloid cells 2a, Triggering receptor expressed on monocytes 2, triggering receptor expressed on myeloid cells 2 |
| Gene ID (Entrez) | 54209 |
| Formulation | Supplied in a saline solution containing BSA and Sodium Azide. with Sodium Azide |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant mouse TREM-2 extracellular domain Accession # Q99NH8 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | Detects human and mouse TREM-2 in direct ELISAs and Western blots. Stains TREM-2 transfectants but not TREM-1 transfectants. |
| Clone | 237920 |
| Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat,Bacteria,Insect,Monkey,Firefly |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin),Functional Assay,KnockDown |
| Form | Purified |
| Isotype | IgG1 κ |
| Gene Accession No. | Q13148 |
| Research Discipline | Cell Cycle and Replication, Chromatin Research, DNA replication Transcription Translation and Splicing, Epigenetics, Immunology, Mitochondrial Fusion Proteins, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Transcription Factors and Regulators, Virology Bacteria and Parasites |
| Antigen | TDP-43/TARDBP |
| Regulatory Status | RUO |
| Purification Method | IgG purified |
| Dilution | Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Functional, Knockdown Validated |
| Gene Alias | ALS10TAR DNA-binding protein-43, TAR DNA binding protein, TDP43, TDP-43, TDP-43TAR DNA-binding protein 43 |
| Gene ID (Entrez) | 23435 |
| Formulation | In 1x PBS, pH 7.4 |
| Classification | Monoclonal |
| Immunogen | TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA |
| Primary or Secondary | Primary |
| Clone | 2E2-D3 |
p62/SQSTM1 Antibody (2C11), R&D Systems™
A Novus product, part of R&D Systems. Mouse Monoclonal Antibody
| Content And Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat,Bovine,Hamster,Rabbit |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin),Immunohistochemistry (Frozen) |
| Form | Purified |
| Isotype | IgG2a κ |
| Gene Accession No. | Q13501 |
| Research Discipline | Adaptive Immunity, Cancer, Chromatin Modifiers, Chromatin Research, DNA Methyltransferases, Epigenetics, Innate Immunity, Tumor Suppressors |
| Antigen | p62/SQSTM1 |
| Regulatory Status | RUO |
| Purification Method | IgG purified |
| Dilution | Western Blot 1:100-1:2000, ELISA, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 10μg/mL, Immunoprecipitation 1:10-1:1000, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500 |
| Gene Alias | A170, Autophagy Receptor P62, DMRV, EBI3-associated protein of 60 kDa, EBI3-associated protein p60, EBIAP, FTDALS3, NADGP, ORCA, OSIL, oxidative stress induced like, p60PDB3, p62, p62B, Paget disease of bone 3, PDB3, phosphotyrosine independent ligand for the Lck SH2 domain p62, Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa, sequestosome 1, sequestosome-1, Ubiquitin-binding protein p62, ZIP3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 8878 |
| Formulation | In 1x PBS, pH 7.4 |
| Classification | Monoclonal |
| Immunogen | SQSTM1 (AAH03139.1, 1 a.a. ~ 440 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL |
| Primary or Secondary | Primary |
| Clone | 2C11 |
Cadherin-11 Antibody (1A5), R&D Systems™
A Novus product, part of R&D Systems. Mouse Monoclonal Antibody
| Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunoprecipitation,Functional Assay |
| Form | Purified |
| Isotype | IgG |
| Gene Accession No. | P55287 |
| Research Discipline | Cancer |
| Antigen | Cadherin-11 |
| Regulatory Status | RUO |
| Purification Method | IgG purified |
| Dilution | Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunoprecipitation, Functional |
| Gene Alias | CAD11OSF-4, cadherin 11, type 2, OB-cadherin (osteoblast), cadherin-11, CDHOB, OB, OB-cadherin, Osteoblast cadherin |
| Product Type | Antibody |
| Gene ID (Entrez) | 1009 |
| Formulation | In 1x PBS, pH 7.4 |
| Classification | Monoclonal |
| Immunogen | CDH11 (P55287, 54 a.a. ~ 612 a.a) partial recombinant protein with Fc tag at C terminal. MW of the Fc tag alone is 50 KDa. 0 |
| Primary or Secondary | Primary |
| Clone | 1A5 |
| Content And Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunohistochemistry (Paraffin) |
| Form | Purified |
| Isotype | IgG1 κ |
| Gene Accession No. | AAH18625 |
| Antigen | MTAP |
| Regulatory Status | RUO |
| Purification Method | IgG purified |
| Dilution | Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin |
| Gene Alias | 5'-methylthioadenosine phosphorylase, c86fus, EC 2.4.2.28, methylthioadenosine phosphorylase, MSAPMeSAdo phosphorylase, MTA phosphorylase, MTAPase, S-methyl-5'-thioadenosine phosphorylase |
| Gene ID (Entrez) | 4507 |
| Formulation | In 1x PBS, pH 7.4 |
| Classification | Monoclonal |
| Immunogen | MTAP (AAH18625, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS |
| Primary or Secondary | Primary |
| Clone | 2G4 |
Promotions Available
Human/Mouse/Rat CD31/PECAM-1 Antibody, R&D Systems™
Human/Mouse/Rat CD31/PECAM-1 Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Chicken,Cynomolgus Monkey,Golden Syrian Hamster,Human,Mouse,Pig,Primate,Rabbit,Rat,Rhesus Macaque,Transgenic Mouse,Xenograft |
| Host Species | Goat |
| Conjugate | Unconjugated |
| Applications | Cell Culture,Cell Selection,CyTOF,Flow Cytometry,Functional Assay,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),In vivo Assay,Simple Western,Western Blot |
| Isotype | IgG |
| Gene Accession No. | Q08481 |
| Concentration | LYOPH |
| Antigen | CD31/PECAM-1 |
| Gene Symbols | PECAM1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.5 ug/mL, Flow Cytometry 0.25 ug/10^6 cells, Immunohistochemistry 3-15 ug/mL, Immunocytochemistry 5-15 ug/mL, CyTOF-ready |
| Gene Alias | adhesion molecule, CD31, CD31 antigen, CD31/EndoCAM, EndoCAM, FLJ34100, FLJ58394, GPIIA', PECA1, PECAM1, PECAM-1, PECAM-1, CD31/EndoCAM, platelet endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1, platelet/endothelial cell adhesion molecule |
| Gene ID (Entrez) | 5175 |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant mouse CD31/PECAM-1 Glu18-Lys590 Accession # Q08481 |
| Classification | Polyclonal |
| Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects mouse CD31/PECAM-1 in direct ELISAs and Western blots. In direct ELISAs and Western blots, approximately 10% cross-reactivity with recombinant human CD31 and recombinant porcine CD31 is observed. Detects mouse CD31 and rat CD31 in flow cytometry. |
Promotions Available
Normal Rabbit IgG, Negative Control, R&D Systems™
Normal Rabbit IgG, Negative Control, R&D Systems™
Rabbit Polyclonal Antibody has been used in 64 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Rabbit |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Control |
| Isotype | IgG |
| Concentration | LYOPH |
| Antigen | IgG |
| Gene Symbols | IGHG1 |
| Purification Method | Protein A or G purified |
| Dilution | Control |
| Gene Alias | Immunoglobulin G, ImmunoglobulinG |
| Gene ID (Entrez) | 3500 |
| Immunogen | NA |
| Classification | Polyclonal |
| Reconstitution | Dissolve the lyophilized rabbit IgG in sterile PBS, pH 7.4. If 1 mL of PBS is used, the antibody concentration will be 1 mg/mL. |
| Test Specificity | Serum was obtained from naive (non-immunized) rabbits and purified for use as normal rabbit IgG. |
Mouse anti-Human IgG1 Fc Secondary Antibody (2C11cc), Allophycocyanin, Novus Biologicals™
Mouse Monoclonal Antibody
| Antigen | IgG1 Fc |
|---|---|
| Regulatory Status | RUO |
| Content And Storage | Store at 4°C in the dark. |
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | APC |
| Applications | ELISA,Immunodiffusion,Immunohistochemistry,Immunohistochemistry (Frozen) |
| Form | Purified |
| Classification | Monoclonal |
| Immunogen | Hybridoma clone has been derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice immunized with IgG from human serum. |
| Primary or Secondary | Secondary |
| Clone | 2C11cc |
His Tag Horseradish Peroxidase-conjugated Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody has been used in 12 publications
| Content And Storage | Do not freeze. 6 months from date of receipt, 2°C to 8°C as supplied. |
|---|---|
| Target Species | Bacteria,E. coli,Liver Fluke,Human,Mouse,Multi-species,Vibrio parahaemolyticus,Yeast |
| Host Species | Mouse |
| Conjugate | HRP |
| Applications | Binding Activity,Bioassay,ELISA Detection (Matched Antibody Pair),ELISA Development,ELISA Development (Detection),Flow Cytometry,Functional Assay,Neutralization,Simple Western,Western Blot |
| Form | Purified |
| Isotype | IgG1 |
| Concentration | LYOPH |
| Antigen | His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Western Blot 1:4000 dilution, Simple Western 1:1000 dilution |
| Gene Alias | 6 His epitope tag, 6X His, 6X-His, H, HHHHHH epitope tag, HHHHHH tag, HIS, His tag, polyHistidine, Poly-histidine |
| Formulation | Supplied as a 0.2 μm filtered solution in Sodium Phosphate and Proclin 300. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with Proclin 300 |
| Immunogen | His-tagged peptide |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | Detects proteins containing accessible consecutive histidine regions. The antibody detects His tags at the amino- or carboxyl-terminus. |
| Clone | AD1.1.10 |
AIF-1/Iba1 Antibody, R&D Systems™
A Novus product, part of R&D Systems. Goat Polyclonal Antibody has been used in 192 publications
| Content And Storage | Store at -20C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Canine,Mouse,Equine,Feline,Human,Mouse,Pig,Rat |
| Host Species | Goat |
| Conjugate | Unconjugated |
| Applications | Dual RNAScope ISH-IHC,Gene Knock-Out,Immunocytochemistry,Immunofluorescence,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Free Floating),Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunohistochemistry (Whole-Mount),Immunoprecipitation,Peptide ELISA,Western Blot |
| Isotype | IgG |
| Gene Accession No. | P55008 |
| Research Discipline | Autoimmune Diseases, Cancer, Cell Biology, Cell Cycle and Replication, Immunology, Inflammation, Lipid and Metabolism, Microglia Markers, Neuroscience |
| Concentration | 0.5 mg/mL |
| Antigen | AIF-1/Iba1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.1 - 1.0 ug/mL, Immunohistochemistry 4 - 6 ug/mL, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 4 - 6 ug/mL, Immunohistochemistry-Frozen, Peptide ELISA Detection Limit 1:128000, Immunohistochemistry Free-Floating, Immunohistochemistry (Whole-Mount), Knockout Validated, Dual RNAscope ISH-IHC |
| Molecular Weight of Antigen | 16.8 kDa |
| Gene Alias | AIF-1, allograft inflammatory factor 1, G1, IBA1, IbaI, interferon gamma responsive transcript, Ionized calcium-binding adapter molecule 1, IRT1, IRT-1, Protein G1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 199 |
| Formulation | Tris saline (20 mM Tris pH 7.3, 150 mM NaCl), 0.5% BSA with 0.02% Sodium Azide |
| Classification | Polyclonal |
| Immunogen | This AIF-1/Iba1 Antibody was developed against a peptide with sequence C-TGPPAKKAISELP, from the C Terminus of the protein sequence according to NP_116573.1; NP_001614.3. |
| Primary or Secondary | Primary |
| Test Specificity | This AIF-1/Iba1 Antibody is expected to recognize isoform 1 (NP_116573.1) and isoform 3 (NP_001614.3). AIF-1/Iba1 is thought to be involved in negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma. |
Human/Mouse/Rat SOX2 Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody has been used in 119 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Asian Tiger Mosquito,Bovine,Marmoset,Canine,Chicken,Cynomolgus Monkey,Ferret,Fish,Human,Mouse,Chimpanzee,Pig,Quail,Rabbit,Rat,Rhesus Macaque,Transgenic Mouse,Xenograft,Xenopus species,Zebrafish |
| Host Species | Goat |
| Conjugate | Unconjugated |
| Applications | Binding Activity,Bioassay,ChIP Assay,Co-immunoprecipitation (Co-IP),Dot Blot,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Mass Spectrometry,Dual RNAScope ISH-IHC,Simple Western,Western Blot |
| Isotype | IgG |
| Gene Accession No. | P48431 |
| Antigen | SOX2 |
| Gene Symbols | SOX2 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 1 ug/mL, Simple Western 5 ug/mL, Immunohistochemistry 3-25 ug/mL, Chromatin Immunoprecipitation (ChIP) 5 ug/5 x 10^6 cells, Immunocytochemistry 5-15 ug/mL |
| Gene Alias | ANOP3, MCOPS3, MGC2413, SRY (sex determining region Y)-box 2, SRY-related HMG-box gene 2, transcription factor SOX2, transcription factor SOX-2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 6657 |
| Immunogen | E. coli-derived recombinant human SOX2 Gly135-Met317 Accession # P48431 |
| Classification | Polyclonal |
| Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human SOX2 in direct ELISAs and Western blots. |
Promotions Available
Human/Mouse/Rat beta-Actin Antibody, R&D Systems™
Human/Mouse/Rat beta-Actin Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human,Golden Syrian Hamster,Mouse,Rat,Transgenic Mouse |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Bioassay,Immunocytochemistry,Immunohistochemistry,Immunoprecipitation,Simple Western,Western Blot |
| Form | Purified |
| Isotype | IgG1 |
| Gene Accession No. | P60709 |
| Antigen | beta-Actin |
| Gene Symbols | ACTB |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Western Blot 0.01 ug/mL, Simple Western 1 ug/mL, Immunocytochemistry 0.1-25 ug/mL |
| Gene Alias | ACTB, actin, beta, actin, cytoplasmic 1, B-Actin, Beta Actin, beta cytoskeletal actin, betaActin, Beta-actin, BRWS1, I(2)-Actin, PS1TP5-binding protein 1, PS1TP5BP1 |
| Gene ID (Entrez) | 60 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
| Immunogen | Peptide containing a sequence at the N-terminus of human beta-Actin Accession # P60709 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human, mouse, and rat beta-Actin in Western blots. |
| Clone | 937215 |