accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,876,360)
Primary Antibody Matched Pairs (7,060)
Protein Interaction Antibody Pairs (1,393)
Protein Phosphorylation Antibody Pairs (73)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (1)
  • (4)
  • (1)

brands

  • (2)
  • (1)
  • (1)
  • (28)
  • (2)
  • (2)
  • (969)
  • (76,153)
  • (14,166)
  • (41)
  • (6)
  • (59,912)
  • (1)
  • (110)
  • (259)
  • (2)
  • (1,310)
  • (575)
  • (2)
  • (1)
  • (11)
  • (1)
  • (1)
  • (24)
  • (1)
  • (4)
  • (4)
  • (1)
  • (13)
  • (1)
  • (1)
  • (2)
  • (24)
  • (3)
  • (4)
  • (2)
  • (1)
  • (10,631)
  • (397)
  • (1)
  • (12)
  • (1)
  • (8)
  • (3)
  • (2)
  • (1)
  • (1)
  • (190)
  • (55)
  • (1)
  • (6)
  • (1)
  • (63)
  • (3)
  • (15)
  • (1)
  • (12)
  • (2)
  • (1)
  • (76)
  • (5)
  • (17)
  • (19)
  • (1)
  • (14,087)
  • (2)
  • (1)
  • (1)
  • (32,198)
  • (83)
  • (468)
  • (2)
  • (1)
  • (11,567)
  • (1)
  • (1)
  • (51)
  • (3,050)
  • (6)
  • (470)
  • (104)
  • (22,741)
  • (1)
  • (4,434)
  • (1)
  • (1)
  • (1)
  • (1)
  • (16,246)
  • (1)
  • (76)
  • (18,947)
  • (139)
  • (203)
  • (3)
  • (2)
  • (62)
  • (1)
  • (1)
  • (2)
  • (28)
  • (5)
  • (1)
  • (3)
  • (10)
  • (415)
  • (2)
  • (13,812)
  • (29)
  • (1)
  • (2)
  • (45)
  • (42)
  • (11,458)
  • (1)
  • (2)
  • (8)
  • (6)
  • (2)
  • (20)
  • (2)
  • (2)
  • (54)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (34)
  • (2)
  • (1)
  • (40)
  • (2)
  • (1)
  • (62)
  • (53)
  • (453)
  • (55)
  • (10)
  • (3)
  • (78)
  • (12)
  • (11)
  • (1,196)
  • (8)
  • (9)
  • (1)
  • (20)
  • (11)
  • (1)
  • (23)
  • (3)
  • (1)
  • (3)
  • (5)
  • (2)
  • (59)
  • (95)
  • (1)
  • (1)
  • (171)
  • (211)
  • (4)
  • (127)
  • (2)
  • (1)
  • (692)
  • (13)
  • (912)
  • (1)
  • (106)
  • (2,102)
  • (114)
  • (2,514)
  • (1)
  • (12)
  • (1)
  • (1)
  • (972)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (122)
  • (1)
  • (63)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (8)
  • (1)
  • (298)
  • (1)
  • (1,815)
  • (2)
  • (1)
  • (1,792)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (6)
  • (16)
  • (1)
  • (23)
  • (11)
  • (12)
  • (2)
  • (1)
  • (2)
  • (2)
  • (143)
  • (33)
  • (1)
  • (41)
  • (1)
  • (19)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (153,787)
  • (54)
  • (2)
  • (3)
  • (3)
  • (133)
  • (1)
  • (1)
  • (9)
  • (1)
  • (118)
  • (1)
  • (2)
  • (4)
  • (191)
  • (1,157)
  • (10)
  • (2)
  • (10)
  • (8)
  • (2)
  • (36)
  • (1)
  • (1)
  • (1)
  • (112)
  • (12,115)
  • (680)
  • (165)
  • (1)
  • (6)
  • (1)
  • (8,396)
  • (1)
  • (16,429)
  • (3)
  • (16)
  • (4)
  • (137)
  • (31)
  • (111)
  • (1)
  • (3)
  • (8)
  • (6)
  • (9)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (1)
  • (2)
  • (1)
  • (12)
  • (1)
  • (1)
  • (30,478)
  • (13)
  • (1)
  • (32)
  • (1)
  • (1)
  • (6)
  • (79)
  • (1)
  • (1)
  • (11)
  • (7)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (24)
  • (40,282)
  • (2)
  • (1)
  • (12,160)
  • (1)
  • (1)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (40)
  • (7)
  • (57)
  • (15)
  • (1,236,030)
  • (3)
  • (1)
  • (5)
  • (16)
  • (4)
  • (1)
  • (28)
  • (548)
  • (1)
  • (11)
  • (2,475)
  • (2)
  • (1)
  • (4)
  • (2)
  • (2)
  • (421)
  • (1)
  • (8)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,426)
  • (136)
  • (1)
  • (1)
  • (1)
  • (554)
  • (27)
  • (19,393)
  • (1)
  • (8)
  • (1)
  • (1)
  • (1,796)
  • (2)
  • (3)
  • (6)
  • (3)
  • (703)
  • (2)
  • (1)
  • (3)
  • (1)
  • (8)
  • (1)
  • (1)
  • (5)
  • (39)
  • (1)
  • (4)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (2,873)
  • (8)
  • (1)
  • (62)
  • (2)
  • (9)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (14)
  • (1)
  • (1)
  • (28)
  • (241)
  • (1)
  • (3)
  • (2)
  • (17)
  • (1)
  • (1)
  • (10)
  • (10)
  • (2)
  • (1)
  • (2)
  • (40)
  • (7)

special interests

  • (154)
  • (767)
  • (165,580)
  • (74)
  • (70,549)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (925)
  • (1,939)
  • (4,412)
Show all

Conjugate

  • (3)
  • (3)
  • (31,152)
  • (9)
  • (1)
  • (29)
  • (2,893)
Show all

Host Species

  • (565)
  • (2,895)
  • (51)
  • (1)
  • (15)
  • (1,777)
  • (726)
Show all

Applications

  • (571)
  • (2)
  • (36)
  • (23)
  • (187)
  • (1,232)
  • (3)
Show all

Target Species

  • (74)
  • (3)
  • (2)
  • (90)
  • (40)
  • (106)
  • (492)
Show all

Classification

  • (1)
  • (81)
  • (105)
  • (885,462)
  • (3,641)
  • (5)
  • (754,222)
Show all

Regulatory Status

  • (336)
  • (964)
  • (1,642,529)

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Form

  • (2,701)
  • (2,159)
  • (1,630)
  • (14)
  • (9)
  • (21)
  • (424,509)
Show all

Molecular Weight (g/mol)

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
Show all

Search Within Results
Keyword Search:
1,756 – 1,770 of 1,806,628 results
1,756

ATP2C1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunocytochemistry/Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Isotype IgG
Gene Accession No. NP_001001486
Concentration 1 mg/mL
Antigen ATP2C1
Gene Symbols ATP2C1
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 1 μg/mL, ELISA 1:100-1:2000, Immunohistochemistry 5 μg/mL, Immunocytochemistry/Immunofluorescence 20 μg/mL, Immunohistochemistry-Paraffin 5 μg/mL
Gene Alias ATPase, Ca++ transporting, type 2C, member 1, BCPM, benign chronic pemphigus (Hailey-Hailey disease), Ca(2+)-sequestering, calcium-transporting ATPase type 2C member 1, EC 3.6.3, HHD, hSPCA1, HUSSY-28, PMR1L, secretory pathway Ca2+/Mn2+ ATPase 1
Gene ID (Entrez) 27032
Formulation PBS with 0.02% Sodium Azide
Classification Polyclonal
Immunogen Antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ATP2C1. The immunogen is located within the last 50 amino acids of ATP2C1. Amino Acid Squence: IKKVERSREKIQKHVS
Primary or Secondary Primary
Test Specificity At least four isoforms of ATP2C1 are known to exist; this antibody will recognize only the three longest isoforms. ATP2C1 antibody will not cross-react with ATP2C2.
1,757

Human BCMA/TNFRSF17 Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications ELISA
Form Purified
Isotype IgG2a
Gene Accession No. Q02223
Antigen BCMA/TNFRSF17
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution ELISA
Gene Alias B cell maturation antigen, B-cell maturation protein, BCMAtumor necrosis factor receptor superfamily member 17, BCMB-cell maturation factor, CD269, CD269 antigen, TNFRSF13A, TNFRSF17, tumor necrosis factor receptor superfamily, member 17
Gene ID (Entrez) 608
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Mouse myeloma cell line NS0-derived recombinant human BCMA/TNFRSF17, Met1-Ala54, Accession # Q02223
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 2490D
1,759

CD14 Mouse anti-Human, PE, Clone: 63D3.rMAb, BD Pharmingen™

Mouse Monoclonal Antibody

Content And Storage Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze. The monoclonal antibody was purified from tissue culture supernatant or ascites by affinity chromatography. The antibody was conjugated to the dye under optimum conditions and unconjugated antibody and free dye were removed.
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Antigen CD14
Regulatory Status RUO
Gene Alias monocyte differentiation antigen CD14; LPS receptor; LPS-R
Formulation Aqueous buffered solution containing BSA and ≤0.09% sodium azide.
Immunogen Human Peripheral Blood Monocytes
Classification Monoclonal
Primary or Secondary Primary
Clone 63D3.rMAb
1,761

Angiopoietin-like Protein 3/ANGPTL3 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Gene Accession No. Q9Y5C1
Research Discipline Signal Transduction
Antigen Angiopoietin-like Protein 3/ANGPTL3
Gene Symbols ANGPTL3
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias ANG-5, angiopoietin 5, Angiopoietin-5, angiopoietin-like 3, Angiopoietin-like protein 3, angiopoietin-related protein 3, ANGPT5angiopoietin-5, FHBL2
Product Type Antibody
Gene ID (Entrez) 27329
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Classification Polyclonal
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRT
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
1,762

Invitrogen™ TIE2 (TEK) Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Content And Storage -20°C
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Lyophilized
Gene Accession No. Q02763, Q02858
Isotype IgG
Concentration 500 μg/mL
Antigen TIE2 (TEK)
Gene Symbols TEK
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias AA517024; Angiopoietin-1 receptor; CD202B; CD202b antigen; EC 2.7.10; EC 2.7.10.1; Endothelial tyrosine kinase; endothelial-specific receptor tyrosine kinase; endothelium-specific receptor tyrosine kinase 2; endothelium-specific receptor tyrosine kinase Tie-2; hTIE2; Hyk; mTIE2; p140 TEK; protein-tyrosine kinase Tie2; STK1; Tek; TEK receptor tyrosine kinase; TEK tyrosine kinase, endothelial; TEKT1; Tektin-1; Tie2; tie-2; tunica interna endothelial cell kinase; Tyrosine kinase with Ig and EGF homology domains-2; tyrosine kinases that contain immunoglobulin-like loops and epidermal growth factor-similar domains 2; tyrosine-protein kinase receptor TEK; Tyrosine-protein kinase receptor Tie-2; VMCM; VMCM1
Gene TEK
Product Type Antibody
Gene ID (Entrez) 21687, 7010
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Immunogen E.coli-derived human TIE2 recombinant protein (Position: Q641-I830).
Classification Polyclonal
Primary or Secondary Primary
1,763

CD117 Mouse anti-Human, APC, Clone: YB5.B8, BD

Mouse Monoclonal Antibody

Content And Storage Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze.
Description KIT; c-Kit; SCFR; PBT; Mast/stem cell growth factor receptor
Target Species Human
Host Species Mouse
Conjugate APC
Applications Flow Cytometry
Isotype IgG1 κ
Concentration 0.2mg/mL
Antigen CD117
Regulatory Status RUO
Purification Method Affinity Purified
Formulation Aqueous buffered solution containing ≤0.09% sodium azide.
Immunogen Acute myelocytic leukemia blasts
Classification Monoclonal
Primary or Secondary Primary
Clone YB5.B8
1,764

Invitrogen™ eGFP Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Tag
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Liquid
Isotype IgG
Concentration 1 mg/mL
Antigen eGFP
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias eGFP; egfp tag; GFP; GFP tag; GFP2; green fluorescence; green fluorescent; Green Fluoresecent Protein; Turbo eGFP
Product Type Antibody
Formulation BBS with no preservative; pH 8.4
Immunogen Purified recombinant eGFP.
Classification Polyclonal
Primary or Secondary Primary
1,765

Mouse GDF-8/Myostatin Propeptide Antibody, R&D Systems™
GREENER_CHOICE

Sheep Polyclonal Antibody has been used in 7 publications

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species Human,Mouse,Transgenic Mouse
Host Species Sheep
Conjugate Unconjugated
Applications Immunoprecipitation,Neutralization,Western Blot
Isotype IgG
Gene Accession No. O08689
Concentration LYOPH
Antigen GDF-8/Myostatin
Gene Symbols MSTN
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.1 ug/mL, Neutralization 10-30 ug/mL
Gene Alias GDF8, GDF-8, GDF8growth differentiation factor 8, growth/differentiation factor 8, MSLHP, MSTN, Myostatin
Gene ID (Entrez) 2660
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen Mouse myeloma cell line NS0-derived recombinant mouse GDF-8/Myostatin Propeptide Asn25-Ser265 Accession # O08689
Classification Polyclonal
Reconstitution Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary Primary
Test Specificity Detects GDF-8/Myostatin Propeptide in direct ELISAs and Western blots. In direct ELISAs, less than 10% cross-reactivity with mature recombinant mouse (rm) GDF-8 is observed and less than 5% cross-reactivity with mature rmGDF-1, -3, -5, -6, -7, -9, and recombinant human GDF-11 is observed.
1,766

Invitrogen™ EGFR Monoclonal Antibody (EGFR1), PE
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Horse,Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. P00533
Isotype IgG2b κ
Concentration 0.09 mg/mL
Antigen EGFR
Gene Symbols EGFR
Regulatory Status RUO
Purification Method Size-exclusion chromatography
Gene Alias 2.7.10.1; 9030024J15Rik; AI552599; avian erythroblastic leukemia viral (v-erbB) oncogene homolog; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; EC 2.7.10.1; egf receptor; Egfr; EGFR-related peptide; epidermal growth factor receptor; epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian); Epidermal growth factor receptor formerly avian erythroblastic leukemia viral (v-erbB) oncogene homolog (Erbb1); epidermal growth factor receptor, formerly avian erythroblastic leukemia viral (v-erbB) oncogene homolog (Erbb1); ERBB; ERBB1; ErbB-1; erb-b2 receptor tyrosine kinase 1; Errb1; Errp; HER1; kinase EGFR; mENA; NISBD2; Oncogene ERBB; PIG61; Proto-oncogene c-ErbB-1; receptor tyrosine-protein kinase erbB-1; Urogastrone; wa2; wa-2; Wa5; waved 2
Gene EGFR
Product Type Antibody
Gene ID (Entrez) 100067755, 1956
Formulation PBS with 0.2% BSA and 15mM sodium azide; pH 7.4
Immunogen Human epidermoid carcinoma line A431.
Classification Monoclonal
Primary or Secondary Primary
Clone EGFR1
1,767

Invitrogen™ GP2 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Gene Accession No. P55259
Isotype IgG
Concentration 0.5 mg/mL
Antigen GP2
Gene Symbols GP2
Regulatory Status RUO
Purification Method Affinity Chromatography
Gene Alias 2310037I18Rik; AV060639; glycoprotein 2; glycoprotein 2 (zymogen granule membrane); glycoprotein 80; GP2; gp80; Pancreatic secretory granule membrane major glycoprotein GP2; pancreatic zymogen granule membrane associated protein GP2; pancreatic zymogen granule membrane protein GP-2; secretory (zymogen) granule membrane glycoprotein GP2; ZAP75; zymogen granule membrane glycoprotein 2
Gene GP2
Product Type Antibody
Gene ID (Entrez) 2813
Formulation PBS with 2% sucrose and 0.09% sodium azide
Immunogen Synthetic peptide directed towards the middle region of human GP2.
Classification Polyclonal
Primary or Secondary Primary
1,768

Invitrogen™ HTR5A Recombinant Rabbit Monoclonal Antibody (HL5019)

Rabbit Recombinant Monoclonal Antibody

ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Gene Accession No. P47898
Isotype IgG
Concentration 1 mg/mL
Antigen HTR5A
Gene Symbols HTR5A
Regulatory Status RUO
Purification Method Protein A
Gene Alias 5-HT-5; 5HT5A; 5-HT5A; 5-HT-5A; 5-HT5a receptor; 5-hydroxytryptamine (serotonin) receptor 5A; 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled; 5-hydroxytryptamine receptor 5A; 5-hydroxytryptamine5a; Htr5; Htr5a; MR22; REC17; Serotonin receptor 5A
Gene HTR5A
Product Type Antibody
Gene ID (Entrez) 3361
Formulation PBS with no preservative
Immunogen Recombinant protein encompassing a sequence within the Extracellular domain of human 5-HT5A receptor. The exact sequence is proprietary.
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone HL5019
1,770

Invitrogen™ EpoR Recombinant Rabbit Monoclonal Antibody (004)
GREENER_CHOICE

Rabbit Recombinant Monoclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA
Form Liquid
Gene Accession No. P19235
Isotype IgG
Concentration 1 mg/mL
Antigen EpoR
Gene Symbols EPOR
Regulatory Status RUO
Purification Method Protein A
Gene Alias EPO R; EPOR; EPO-R; Erythropoietin receptor; pEpoR
Gene EPOR
Product Type Antibody
Gene ID (Entrez) 2057
Formulation PBS with no preservative
Immunogen Recombinant Human EPOR Protein (Met1-Pro250).
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone 004