Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Clearance (1)
New Lab Start-Up (4)
Offers (1)

special interests

Available on GSA/VA Contract (154)
Fast Shipping (767)
Greener Choice (165,580)
Production Products (74)
Small and Specialty Supplier (70,549)

Quantity

0.002 g (1)
0.01 mg (7)
0.015 mg (2)
0.02 mL (3,051)
0.02 mg (925)
0.025 mL (1,939)
0.025 mg (4,412)

Show all

Conjugate

ABflo 488 (3)
ABflo 647 (3)
APC (31,152)
APC-Alexa Fluor 750 (9)
APC-Cy7 (1)
APC-Cyanine5.5 (29)
APC-Cyanine7 (2,893)

Show all

Host Species

Alpaca (565)
Armenian Hamster (2,895)
Biosimilar (51)
Bovine (1)
Canine (15)
Chicken (1,777)
Chinese Hamster (CHO) (726)

Show all

Applications

(571)
ADCC (2)
Activation (36)
Activity (23)
Adhesion Activation (187)
Adhesion Blockade (1,232)
Adoptive Transfer (3)

Show all

Target Species

(74)
A. leptorhynchus (3)
A. nidulans (2)
A. thaliana (90)
Adeno-associated Virus (AAV) (40)
Adenovirus (106)
African Green Monkey (492)

Show all

Classification

Animal Origin-free (1)
Cocktail (81)
Low Endotoxin/Azide-free (LE/AF) (105)
Monoclonal (885,462)
Monoclonal/Polyclonal (3,641)
Oligoclonal (5)
Polyclonal (754,222)

Show all

Regulatory Status

ASR (336)
IVD (964)
RUO (1,642,529)

Isotype

(VH-CH2-CH3)2 (2)
Bispecific Homodimer (VK-VH-VL'-VH', Tandem diabody);Kappa;Lambda (1)
Bispecific Mixed mAb and scFv IgG1;naKappa;Kappa (2)
Bispecific Single Domains (VH-VH'-CH),IgG1na;na (1)
Bispecific scFv with Domain Crossover κLambda (1)
Bispecific scFv, IgG4;Kappa;Kappa (1)
Bispecific scFv;Kappa;Lambda (6)

Show all

Form

Antisera (2,701)
Ascites (2,159)
Concentrated (1,630)
Culture Supernatant (14)
Diluted (9)
Frozen (21)
Liquid (424,509)

Show all

Molecular Weight (g/mol)

104.58 (1)
108.18 (1)
121.14 (1)
121.18 (1)
124.18 (1)
128.21 (1)
136.08 g/mol (1)

Show all

Search Within Results

1,786 – 1,800 of 1,806,628 results

1,786

CD203c Mouse anti-Human, APC, Clone: NP4D6, BD

Mouse Monoclonal Antibody

Pricing & Availability

1,787

CD141 Mouse anti-Human, PE, Clone: 1A4, BD

Mouse Monoclonal Antibody

Pricing & Availability

1,788

CD62L Mouse anti-Human, BUV395, Clone: SK11, BD

Mouse Monoclonal Antibody

Pricing & Availability

1,789

CD62L Mouse anti-Human, BB515, Clone: DREG-56, BD

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze.
Description	SELL; L-selectin; LSEL; LAM-1; LECAM-1; LEU8; LNHR; MEL-14; PLNHR; TQ-1
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Blue 515 (BB515)
Applications	Flow Cytometry
Isotype	IgG1 κ
Antigen	CD62L
Regulatory Status	RUO
Purification Method	Affinity Purified
Formulation	Aqueous buffered solution containing ≤0.09% sodium azide.
Immunogen	Supernatant from PMA-activated Human Peripheral Blood Leukocytes
Classification	Monoclonal
Primary or Secondary	Primary
Clone	DREG-56

1,790

Glycogen Synthase Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate	Unconjugated
Target Species	Human
Host Species	Rabbit
Applications	Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Isotype	IgG
Antigen	Glycogen Synthase
Regulatory Status	RUO
Purification Method	Affinity Purified
Gene Alias	EC 2.4.1.11, glycogen [starch] synthase, muscle, glycogen synthase 1 (muscle), GYSGSY
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	2997
Classification	Polyclonal
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: PSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSE
Primary or Secondary	Primary

1,791

Human IFN-gamma Antibody, R&D Systems™

Goat Polyclonal Antibody has been used in 12 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human,Rhesus Macaque,Xenograft
Host Species	Goat
Conjugate	Unconjugated
Applications	Bioassay,Immunocytochemistry,Immunohistochemistry,Immunohistochemistry (Paraffin),Neutralization,Western Blot
Isotype	IgG
Gene Accession No.	Q14609
Concentration	LYOPH
Antigen	IFN-gamma
Gene Symbols	IFNG
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 0.1 ug/mL, Neutralization 0.0300 - 0.300 ug/mL, Immunocytochemistry 5-15 ug/mL
Gene Alias	IFG, IFI, IFNG, IFNgamma, IFN-gamma, Immune interferon, interferon gamma, interferon, gamma
Product Type	Antibody
Gene ID (Entrez)	3458
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	E. coli-derived recombinant human IFN-gamma (R&D Systems, Catalog # 285-IF) Met1-Gln144 Accession # Q14609
Classification	Polyclonal
Reconstitution	Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human IFN-gamma in direct ELISAs and Western blots. In direct ELISAs, less than 5% cross-reactivity with recombinant rat IFN-gamma and recombinant mouse IFN-gamma is observed.

1,792

Glucagon Mouse, PE, Clone: U16-850, BD Pharmingen™

Mouse Monoclonal Antibody

Pricing & Availability

1,793

Urocortin 3 Antibody, Novus Biologicals™

Goat Polyclonal Antibody

Pricing & Availability
Specifications

Antigen	Urocortin 3
Regulatory Status	RUO
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Goat
Conjugate	Unconjugated
Applications	Peptide ELISA,Western Blot
Gene ID (Entrez)	114131
Classification	Polyclonal
Immunogen	Peptide with sequence C-KPRQDTAKSPHRTK corresponding to internal region according to NP_444277.2.
Primary or Secondary	Primary

1,794

Invitrogen™ Human IgG Monoclonal Antibody (KT48)

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rat
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin)
Form	Liquid
Isotype	IgG2a
Concentration	0.77 mg/mL
Antigen	Human IgG
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	Immunoglobulin G; ImmunoglobulinG
Product Type	Antibody
Formulation	PBS with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Immunogen	A fusion protein contains human IgG Fc.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	KT48

1,795

Invitrogen™ KLF4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O43474, Q60793
Isotype	IgG
Concentration	1.0 mg/mL
Antigen	KLF4
Gene Symbols	KLF4
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	endothelial Kruppel-like zinc finger protein; epithelial zinc finger protein EZF; Ezf; Gklf; gut Kruppel-like factor; gut-enriched krueppel-like factor; high mobility group nucleosomal binding domain 3; high mobility group nucleosome-binding domain-containing protein 3; HMGN3; KLF4; Krueppel-like factor 4; Kruppel like factor 4; Kruppel-like factor 4 (Gut enriched kruppel-like factor) (Epithelial zinc-finger protein EZF); Kruppel-like factor 4 (gut); PNAS-24; PNAS-25; RP11-150J11.1; thyroid hormone receptor interacting protein 7; Thyroid receptor-interacting protein 7; TR-interacting protein 7; TRIP7; Zie
Gene	KLF4
Product Type	Antibody
Gene ID (Entrez)	16600, 9314
Formulation	PBS with 20% glycerol and 0.01% thimerosal; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human KLF4. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

1,796

CD45 Mouse, Brilliant Violet 711, Clone: D058-1283, BD Optibuild™

Mouse Monoclonal Antibody

Pricing & Availability

1,797

Human PD-1 Antibody, R&D Systems™

Goat Polyclonal Antibody has been used in 26 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Sooty Mangabey,Chinese Hamster,Feline,Human,Mouse,Primate,Rhesus Macaque
Host Species	Goat
Conjugate	Unconjugated
Applications	Bioassay,Blockade of Receptor-ligand Interaction,CyTOF,Dual RNAScope ISH-IHC,ELISA Capture (Matched Antibody Pair),ELISA Development,Flow Cytometry,Functional Assay,Immunocytochemistry,Immunohistochemistry,Immunohistochemistry (Paraffin),Microarray,Neutralization,Surface Plasmon Resonance,Western Blot
Isotype	IgG
Gene Accession No.	Q8IX89
Concentration	LYOPH
Antigen	PD-1
Gene Symbols	PDCD1
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 0.5-2 ug/mL, Flow Cytometry 0.25 ug/10^6 cells, Immunohistochemistry 5-15 ug/mL, Blockade of Receptor-ligand Interaction, CyTOF-ready, ELISA Capture (Matched Antibody Pair) 0.2-0.8 ug/mL
Gene Alias	CD279, CD279 antigen, hPD-1, PD1, PD1hPD-l, PDCD1, programmed cell death 1, programmed cell death protein 1, Protein PD-1, SLEB2
Product Type	Antibody
Gene ID (Entrez)	5133
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	Mouse myeloma cell line NS0-derived recombinant human PD-1 Leu25-Gln167 Accession # Q8IX89
Classification	Polyclonal
Reconstitution	Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human PD-1 in ELISAs and Western blots. In sandwich ELISAs, less than 2% cross-reactivity with recombinant mouse PD-1 and less than 0.2% cross-reactivity with recombinant human (rh) CD28, rhICOS, and rhCTLA-4 is observed.

1,798

STEAP2 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunocytochemistry/Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Isotype	IgG
Gene Accession No.	Q8NFT2
Concentration	1 mg/mL
Antigen	STEAP2
Gene Symbols	STEAP2
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 1-2 ug/ml, ELISA 1:100-1:2000, Immunohistochemistry 2.5 ug/ml, Immunocytochemistry/Immunofluorescence 20 ug/mL, Immunohistochemistry-Paraffin 2.5 ug/ml
Molecular Weight of Antigen	55 kDa
Gene Alias	EC 1.16.1, EC 1.16.1.-, IPCA1, metalloreductase STEAP2, PCANAP1STMP, prostate cancer associated protein 1, Prostate cancer-associated protein 1, Protein upregulated in metastatic prostate cancer, PUMPCn, six transmembrane epithelial antigen of prostate 2, six transmembrane epithelial antigen of the prostate 2, Six-transmembrane epithelial antigen of prostate 2, SixTransMembrane protein of prostate 1, STAMP1IPCA-1
Gene ID (Entrez)	261729
Formulation	PBS with 0.02% Sodium Azide
Classification	Polyclonal
Immunogen	Antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human STEAP2. The immunogen is located within the last 50 amino acids of STEAP2. Amino Acid Squence: KLKRIKKGWEKSQFLE
Primary or Secondary	Primary
Test Specificity	This STEAP2 antibody does not cross-react with other STEAP proteins.

1,799

RFK Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA
Form	Purified
Isotype	IgG
Research Discipline	Lipid and Metabolism
Antigen	RFK
Regulatory Status	RUO
Purification Method	Antigen and protein A Affinity-purified
Dilution	ELISA 1:5000-1:10000
Gene Alias	ATP:riboflavin 5'-phosphotransferase, EC 2.7.1.26, Flavokinase
Product Type	Antibody
Gene ID (Entrez)	55312
Formulation	0.2 um filtered solution in PBS
Classification	Polyclonal
Immunogen	Produced in rabbits immunized with purified, recombinant Human RFK (Uniprot#: Q969G6; Met1-His155)
Primary or Secondary	Primary

1,800

RB705 Rat Anti-Human CXCR5 (CD185), BD OptiBuild™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze. The monoclonal antibody was purified from tissue culture supernatant or ascites by affinity chromatography. The antibody was conjugated to the dye under optimum conditions that minimize unconjugated dye and antibody.
Target Species	Human
Host Species	Rat
Conjugate	RB705
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Concentration	0.2 mg/mL
Antigen	CXCR5 (CD185)
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	CD185; Chemokine C-X-C motif receptor 5; BLR1; MDR-15
Gene ID (Entrez)	643
Formulation	Aqueous buffered solution containing ≤0.09% sodium azide.
Classification	Monoclonal
Immunogen	Human CXCR5 (CD185)
Clone	RF8B2

Primary Antibodies

Filtered Search Results

Narrow Results

Human IFN-gamma Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Human IgG Monoclonal Antibody (KT48) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ KLF4 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human PD-1 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human IFN-gamma Antibody, R&D Systems™

Invitrogen™ Human IgG Monoclonal Antibody (KT48)

Invitrogen™ KLF4 Polyclonal Antibody

Human PD-1 Antibody, R&D Systems™