Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

211 – 225 of 1,599,980 results

211

CD152 (CTLA-4) Monoclonal Antibody (14D3), APC, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Rhesus Macaque
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P16410
Concentration	5 μL/Test
Antigen	CD152 (CTLA-4)
Gene Symbols	CTLA4
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	ALPS5; CD; CD152; CD152 antigen; CD152 isoform; CD152 protein; CD152 protein precursor; celiac disease 3; CELIAC3; Ctla4; CTLA-4; cytotoxic T lymphocyte associated antigen 4 short spliced form; cytotoxic T-lymphocyte associated protein 4; cytotoxic T-lymphocyte protein 4; cytotoxic T-lymphocyte protein 4 isoform CTLA4-TM; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated protein 4; cytotoxic T-lymphocyte-associated serine esterase-4; EGK_04712; GRD4; GSE; ICOS; IDDM12; insulin-dependent diabetes mellitus 12; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; Ly-56; sCTLA4; soluble form; transmembrane form
Gene	CTLA4
Product Type	Antibody
Gene ID (Entrez)	1493, 705673
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	14D3

212

Invitrogen™ APE1 Monoclonal Antibody (13B 8E5C2)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat,Canine,Monkey
Host Species	Mouse
Conjugate	Unconjugated
Applications	ChIP Assay,Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,RNA Immunoprecipitation,Immunocytochemistry
Form	Liquid
Gene Accession No.	P27695, P28352, P43138
Isotype	IgG2a
Concentration	1 mg/mL
Antigen	APE1
Gene Symbols	APEX1
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	AP endonuclease 1; AP endonuclease class I; AP lyase; Ape; APE1; APEN; Apex; APEX nuclease; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX nuclease 1; Apex1; apurinic/a; Apurinic/apy; apurinic/apyrimidinic (abasic) endonuclease; apurinic/apyrimidinic endodeoxyribonuclease 1; apurinic/apyrimidinic endonuclease; apurinic/apyrimidinic endonuclease 1; Apurinic-apyrimidinic endonuclease 1; APX; BAP 1; BAP1; deoxyribonuclease (apurinic or apyrimidinic); DNA-(apurinic or apyrimidinic site) endonuclease; DNA-(apurinic or apyrimidinic site) lyase; DNA-(apurinic or apyrimidinic site) lyase, mitochondrial; HAP1; protein REF-1; redox factor 1; redox factor-1; REF1; REF-1
Gene	APEX1
Product Type	Antibody
Gene ID (Entrez)	11792, 328, 482558, 79116
Formulation	PBS with 0.05% sodium azide
Immunogen	Full-length recombinant human APE protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	13B 8E5C2

213

Invitrogen™ SERCA2 ATPase Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	O55143, P11507, P16615
Isotype	IgG
Concentration	500 μg/mL
Antigen	SERCA2 ATPase
Gene Symbols	Atp2a2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	9530097L16Rik; ATP2; Atp2a2; ATP2B; ATPase Ca++ transporting cardiac muscle slow twitch 2; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2; ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2; ATPase, Ca++ transporting, slow twitch 2; Ca(2+)-transport ATPase class 3; calcium ATPase; calcium pump 2; calcium-ATPase (EC 3.6.1.3); calcium-transporting ATPase; calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform; cardiac Ca2+ ATPase; D5Wsu150e; DAR; DD; endoplasmic reticulum class 1/2 Ca(2+) ATPase; mKIAA4195; putative SERCA isoform; sarco(endo)plasmic reticulum Ca(2+)-dependent ATPase 2; sarco/endoplasmic reticulum Ca2+-ATPase 2; sarcoplasmic reticulum Ca2+-transport ATPase isoform; sarcoplasmic/endoplasmic reticulum calcium ATPase 2; sarcoplasmic/endoplasmic-reticulum Ca(2+) pump gene 2; SERCA; SERCA ATPase; SERCA2; Serca2a; SERCA2B; SercaII; SR Ca(2+)-ATPase 2; unnamed protein product
Gene	Atp2a2
Product Type	Antibody
Gene ID (Entrez)	11938, 29693, 488
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA2 ATPase (1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL).
Classification	Polyclonal
Primary or Secondary	Primary

214

Invitrogen™ PSMA Monoclonal Antibody (GCP-05), Alexa Fluor™ 488

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q04609
Isotype	IgG1
Concentration	1.0 mg/mL
Antigen	PSMA
Gene Symbols	FOLH1
Regulatory Status	RUO
Purification Method	Size-exclusion chromatography
Gene Alias	Cell growth-inhibiting gene 27 protein; FGCP; folate hydrolase (prostate-specific membrane antigen) 1; folate hydrolase 1; FOLH; Folh1; Folylpoly-gamma-glutamate carboxypeptidase; GCP2; GCPII; GIG27; glutamate carboxylase II; glutamate carboxypeptidase 2; Glutamate carboxypeptidase II; membrane glutamate carboxypeptidase; mGCP; mopsm; Naalad; NAALAD1; NAALAdase; NAALADase I; N-acetylated alpha-linked acidic dipeptidase; N-acetylated alpha-linked acidic dipeptidase 1; N-acetylated-alpha-linked acidic dipeptidase I; prostate specific membrane antigen; prostate specific membrane antigen variant F; prostate-specific membrane antigen; Prostate-specific membrane antigen homolog; PSM; PSMA; pteroylpoly-gamma-glutamate carboxypeptidase
Gene	FOLH1
Product Type	Antibody
Gene ID (Entrez)	2346
Formulation	PBS with 15mM sodium azide
Immunogen	Amino acids 44-750 of human GCPII.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	GCP-05

215

Invitrogen™ NeuN Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Fish
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	A6NFN3, Q8BIF2
Isotype	IgG
Concentration	1.85 mg/mL
Antigen	NeuN
Gene Symbols	RBFOX3
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	D11Bwg0517e; FLJ56884; FLJ58356; fox 1 homolog (C. elegans) 3; fox1 homolog C; Fox-1 homolog C; FOX3; FOX-3; FOX3NeuN; hexaribonucleotide binding protein 3; hexaribonucleotide binding protein 3 (HRNBP3); Hexaribonucleotide-binding protein 3; Hrnbp3; NEUN; NeuN antigen; Neuna60; neuronal nuclear antigen A60; neuronal nuclei; Neuronal nuclei antigen; RBFOX3; RFOX3; RGD1560070; RNA binding fox-1 homolog 3; RNA binding protein; RNA binding protein fox-1 homolog 3; RNA binding protein, fox-1 homolog (C. elegans) 3; RNA binding protein, fox-1 homolog 3
Gene	RBFOX3
Product Type	Antibody
Gene ID (Entrez)	146713, 287847, 52897
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Carrier-protein conjugated synthetic peptide encompassing a sequence within the N-terminus region of human NeuN. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

216

Invitrogen™ Transferrin Receptor Monoclonal Antibody (MEM-75), Alexa Fluor™ 647

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor 647
Applications	Flow Cytometry,Immunocytochemistry
Form	Liquid
Gene Accession No.	P02786
Isotype	IgG1 κ
Concentration	0.16 mg/mL
Antigen	Transferrin Receptor
Gene Symbols	TFRC
Regulatory Status	RUO
Purification Method	Size-exclusion chromatography
Gene Alias	2610028K12Rik; AI195355; AI426448; AU015758; CD antigen CD71; CD71; chicken transferrin receptor; E430033M20Rik; I79_000642; IMD46; mammary tumor virus receptor 1; Mtvr1; Mtvr-1; p90; sTfR; T9; TfR; tfR1; TFR2; TFRC; TR; transferrin receptor; transferrin receptor (p90, CD71); transferrin receptor 2; transferrin receptor protein 1; Transferrin receptor protein 1, serum form; Trfr
Gene	TFRC
Product Type	Antibody
Gene ID (Entrez)	7037
Formulation	PBS with 0.2% BSA and 15mM sodium azide
Immunogen	NALM-6 human pre-B cell line.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MEM-75

217

MAP2 Antibody, Novus Biologicals™

Chicken Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Feline,Human,Mouse,Rat
Host Species	Chicken
Conjugate	Unconjugated
Applications	Immunocytochemistry/Immunofluorescence,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),KnockDown,Proximity Ligation Assay,Western Blot
Form	Precipitation
Isotype	IgY
Gene Accession No.	P11137
Research Discipline	Cellular Markers, Cytoskeleton Markers, MAP Kinase Signaling, Neuronal Stem Cells, Neuroscience, Stem Cell Markers
Antigen	MAP2
Gene Symbols	MAP2
Regulatory Status	RUO
Purification Method	Ammonium sulfate precipitation
Dilution	Western Blot 1:10000-1:20000, Immunohistochemistry 1:1000-1:5000, Immunocytochemistry/Immunofluorescence 1:5000-1:10000, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen 1:1000-1:5000, Knockdown Validated
Molecular Weight of Antigen	199 kDa
Gene Alias	DKFZp686I2148, MAP-2, MAP2A, MAP2B, MAP2C, Microtubule Associated Protein 2, microtubule-associated protein 2, MTAP2
Gene ID (Entrez)	4133
Formulation	Supplied as concentrated IgY in PBS with 5mM Sodium Azide
Classification	Polyclonal
Immunogen	This MAP2 antibody was developed against a mix of recombinant human construct of projection domain sequences, amino acids 377-1505: Prot-r-MAP2-P1, Prot-r-MAP2-P2 and Prot-r-MAP2-P3.
Primary or Secondary	Primary
Test Specificity	This antibody was raised against recombinant constructs of the entire human projection domain, and so recognizes the high molecular MAP2 forms, MAP2A and MAP2B.

218

Invitrogen™ CD4 Monoclonal Antibody (S3.5), APC

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P01730
Isotype	IgG2a
Antigen	CD4
Gene Symbols	CD4
Regulatory Status	ASR
Purification Method	Purified
Gene Alias	Activation B7-1 antigen; B7; B7.1; B7-1; BB1; B-lymphocyte activation antigen B7; CD28LG; CD28LG1; CD4; CD4 antigen; CD4 antigen (p55); CD4 antigen p55; Cd4 molecule; CD4 precursor; CD4 receptor; CD4, allele 1; cd4a; CD4mut; CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); CD80 molecule; cell surface glycoprotein CD4; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; fCD4; L3T4; LAB7; Leu-3; Ly-4; lymphocyte antigen CD4; lymphocyte antigen CD4 precursor; membrane protein; p55; T-cell differentiation antigen L3T4; T-cell surface antigen T4/Leu-3; T-cell surface glycoprotein CD4; T-cell surface glycoprotein CD4 precursor (T-cell surface antigen T4/Leu-3) (T-cell differentiation antigen L3T4); T-lymphocyte activation antigen CD80; W3/25; W3/25 antigen
Gene	CD4
Product Type	Antibody
Gene ID (Entrez)	920
Formulation	PBS with sucrose, BSA and 0.1% sodium azide
Immunogen	Human CD4.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	S3.5

219

Invitrogen™ MCP-1 Monoclonal Antibody (2D8)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Monkey
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P10148, P13500
Isotype	IgG1
Concentration	1 mg/mL
Antigen	MCP-1
Gene Symbols	Ccl2
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	Acidic seminal fluid protein; AI323594; C-C motif chemokine 2; C-C motif chemokine ligand 2; Ccl2; chemokine (C-C motif) ligand 2; GDCF-2; HC11; H-MCP-1; HSMCR30; immediate-early serum-responsive JE protein; immediate-early serum-responsive protein JE; Je; MCAF; Mcp1; MCP-1; MCP1A; MCP-1A; MGC9434; Monocyte chemoattractant protein 1; monocyte chemoattractant protein-1; monocyte chemotactic and activating factor; Monocyte chemotactic protein 1; monocyte chemotactic protein 1A; Monocyte secretory protein JE; monocyte-chemoattractant protein-1 precursor; platelet-derived growth factor-inducible protein JE; RP23-350G1.3; SCYA2; Sigje; small inducible cytokine A2; small inducible cytokine A2 (monocyte chemotactic protein 1, homologous to mouse Sig-je); small inducible cytokine subfamily A (Cys-Cys), member 2; small inducible gene JE; small-inducible cytokine A2; SMC-CF
Gene	Ccl2
Product Type	Antibody
Gene ID (Entrez)	20296, 6347
Formulation	PBS with 0.05% sodium azide
Immunogen	Purified recombinant fragment of human CCL2 expressed in E. Coli.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2D8

220

Promotions Available

Human/Mouse TREM2 APC-conjugated Antibody, R&D Systems™

Rat Monoclonal Antibody has been used in 5 publications

Pricing & Availability

221

Invitrogen™ CD138 Monoclonal Antibody (MI15)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human,Monkey,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form	Liquid
Gene Accession No.	P18827
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	CD138
Gene Symbols	Sdc1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AA408134; AA409076; CD antigen 138; CD138; CD138 antigen; heparan sulfate proteoglycan fibroblast growth factor receptor; HSPG; sCD138; SDC; Sdc1; soluble CD138; Sstn; syn-1; Synd; SYND1; Synd-1; SYNDECA; syndecan; syndecan 1; syndecan proteoglycan 1; Syndecan1; syndecan-1; synstatin
Gene	Sdc1
Product Type	Antibody
Gene ID (Entrez)	6382
Formulation	PBS with 15mM sodium azide; pH 7.4
Immunogen	A mixture of U266 and XG-1 human myeloma cell lines.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MI15

222

Invitrogen™ EN1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P09065, Q05925
Isotype	IgG
Concentration	0.45 mg/mL
Antigen	EN1
Gene Symbols	EN1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography, Protein A
Gene Alias	En1; En-1; engrailed 1; engrailed homeobox 1; engrailed homolog 1; engrailed-1; HME1; homeobox protein en-1; Homeobox protein engrailed-1; hu-En-1; Mo-en.1; mo-En-1
Gene	EN1
Product Type	Antibody
Gene ID (Entrez)	13798, 2019
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human EN1 (Engrailed 1).
Classification	Polyclonal
Primary or Secondary	Primary

223

Invitrogen™ ALK Monoclonal Antibody (SP8)

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunocytochemistry
Form	Liquid
Gene Accession No.	P97793, Q9UM73
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	ALK
Gene Symbols	ALK
Regulatory Status	RUO
Gene Alias	Alk; ALK tyrosine kinase receptor; ALK/NPM1 fusion gene; anaplastic lymphoma kinase; Anaplastic lymphoma kinase Ki1; Anaplastic Lymphoma Kinase p80; anaplastic lymphoma receptor tyrosine kinase; CD246; CD246 antigen; EC 2.7.10.1; kinase ALK; mutant anaplastic lymphoma kinase; NBLST3; npm-alk; p80; Tcrz; TFG/ALK
Gene	ALK
Product Type	Antibody
Gene ID (Entrez)	11682, 238
Formulation	Tissue culture supernatant, TBS with 1% BSA and 0.1% sodium azide; pH 7.5
Immunogen	Recombinant fragment within ALK aa 1350-1500. The exact sequence is proprietary.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SP8

224

Invitrogen™ G3BP1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P97855, Q13283
Isotype	IgG
Concentration	0.35 mg/mL
Antigen	G3BP1
Gene Symbols	G3BP1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI849976; ATP-dependent DNA helicase VIII; B430204O07; C87777; DNA helicase VIII; G3BP; G3BP stress granule assembly factor 1; G3bp1; G3BP-1; GAP binding protein; GAP SH3 binding protein; GAP SH3 domain-binding protein 1; GTPase activating protein (SH3 domain) binding protein 1; hDH VIII; HDH-VIII; MGC111040; mKIAA4115; Ras GTPase-activating protein-binding protein 1; RasGAP-associated endoribonuclease G3BP; Ras-GTPase-activating protein SH3-domain binding protein 1; Ras-GTPase-activating protein SH3-domain-binding protein; RGD1310666
Gene	G3BP1
Product Type	Antibody
Gene ID (Entrez)	10146, 171092, 27041
Formulation	PBS with 20% glycerol, 1% BSA and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human G3BP1. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

225

Invitrogen™ Glucocorticoid Receptor alpha Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ChIP Assay,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	P04150, P06536, P06537
Isotype	IgG
Concentration	1 mg/mL
Antigen	Glucocorticoid Receptor alpha
Gene Symbols	Nr3c1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	cytosolic/nuclear receptor; fb13f09; GCCR; Gcr; GCRST; glucocorticoid nuclear receptor variant 1; glucocorticoid receptor; glucocorticoid receptor 1; glucocorticoid receptor alpha; GR; gr alpha; GR Kit; Grl; Grl1; Grl-1; Nr3c1; Nuclear receptor subfamily 3 group C member 1; nuclear receptor subfamily 3, group C, member 1; nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor); OTTHUMP00000222854; OTTHUMP00000222858; utouto; utut; wu:fb13f09; zgc:113038
Gene	Nr3c1
Product Type	Antibody
Gene ID (Entrez)	14815, 24413, 2908
Formulation	PBS with 0.05% sodium azide
Immunogen	Synthetic Peptide: C(755) E I I T N Q I P K Y S N G N I K K(771).
Classification	Polyclonal
Primary or Secondary	Primary

Prev
1
...
13
14
15
16
...
106,666
Next

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ APE1 Monoclonal Antibody (13B 8E5C2) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SERCA2 ATPase Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PSMA Monoclonal Antibody (GCP-05), Alexa Fluor™ 488 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NeuN Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Transferrin Receptor Monoclonal Antibody (MEM-75), Alexa Fluor™ 647 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

MAP2 Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Invitrogen™ CD4 Monoclonal Antibody (S3.5), APC Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MCP-1 Monoclonal Antibody (2D8) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human/Mouse TREM2 APC-conjugated Antibody, R&D Systems™ GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD138 Monoclonal Antibody (MI15) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ EN1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ALK Monoclonal Antibody (SP8) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ G3BP1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Glucocorticoid Receptor alpha Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ APE1 Monoclonal Antibody (13B 8E5C2)

Invitrogen™ SERCA2 ATPase Polyclonal Antibody

Invitrogen™ PSMA Monoclonal Antibody (GCP-05), Alexa Fluor™ 488

Invitrogen™ NeuN Polyclonal Antibody

Invitrogen™ Transferrin Receptor Monoclonal Antibody (MEM-75), Alexa Fluor™ 647

MAP2 Antibody, Novus Biologicals™

Invitrogen™ CD4 Monoclonal Antibody (S3.5), APC

Invitrogen™ MCP-1 Monoclonal Antibody (2D8)

Human/Mouse TREM2 APC-conjugated Antibody, R&D Systems™

Invitrogen™ CD138 Monoclonal Antibody (MI15)

Invitrogen™ EN1 Polyclonal Antibody

Invitrogen™ ALK Monoclonal Antibody (SP8)

Invitrogen™ G3BP1 Polyclonal Antibody

Invitrogen™ Glucocorticoid Receptor alpha Polyclonal Antibody