Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

2,281 – 2,295 of 1,816,563 results

2,281

Carbonic Anhydrase IX/CA9 Antibody, Alexa Fluor™ 750, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Antigen	Carbonic Anhydrase IX/CA9
Regulatory Status	RUO
Content And Storage	Store at 4°C in the dark.
Target Species	Human,Mouse,Plant,Rat
Host Species	Rabbit
Conjugate	Alexa Fluor 750
Applications	ChIP Assay,Dual RNAScope ISH-IHC,ELISA,Flow Cytometry,Gel Supershift,Immunoblot,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Microarray,Proximity Ligation Assay,Western Blot
Gene ID (Entrez)	768
Classification	Polyclonal
Immunogen	A synthetic peptide made to a C-terminal sequence of human Carbonic Anhydrase IX (within residues 400-459) [UniProt Q16790]
Primary or Secondary	Primary

2,282

Invitrogen™ CYP26A1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	O43174, O55127
Isotype	IgG
Concentration	2 mg/mL
Antigen	CYP26A1
Gene Symbols	CYP26A1
Regulatory Status	RUO
Purification Method	Ammonium sulfate precipitation, Size-exclusion - Dialysis
Gene Alias	CP26; Cyp26; CYP26A1; Cytochrome P450 26A1; cytochrome P450 family 26 subfamily A member 1; cytochrome P450 retinoic acid-inactivating 1; cytochrome P450, 26, retinoic acid; cytochrome P450, 26, retinoic acid A1; cytochrome P450, family 26, subfamily A, polypeptide 1; cytochrome P450, subfamily XXVIA, polypeptide 1; cytochrome P450RAI; hP450RAI; P450, retinoic acid-inactivating, 1; P450RA; P450RAI; P450RAI1; RAH; Retinoic acid 4-hydroxylase; retinoic acid hydrolase; retinoic acid hydroxylase; retinoic acid-metabolizing cytochrome
Gene	CYP26A1
Product Type	Antibody
Gene ID (Entrez)	13082, 1592
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	KLH conjugated synthetic peptide between 467-497 amino acids from the C-terminal region of human CYP26A1.
Classification	Polyclonal
Primary or Secondary	Primary

2,283

CD11b/c Mouse Anti-Rat, Brilliant Violet 510, Clone: OX-42, BD Optibuild™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Antigen	CD11b/c
Regulatory Status	RUO
Content And Storage	Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze.
Gene Alias	Itgam/Integrin, alpha M, C3bi receptor, CR3, Itgad/Integrin, alpha D
Conjugate	Brilliant Violet 510
Target Species	Mouse
Host Species	Mouse
Formulation	Aqueous buffered solution containing ≤0.09% sodium azide.
Classification	Monoclonal
Immunogen	Resident peritoneal cells from (PVG.RT1[c] x PVG.RT1[u]) and (PVG.RT1[c] x PVG.RT1[a]) F1-hybrid rat
Isotype	IgG2a κ
Primary or Secondary	Primary
Clone	OX-42

2,284

CD8a Mouse anti-Rat, Brilliant Violet 605, Clone: OX-8, BD Optibuild™

Mouse Monoclonal Antibody

Pricing & Availability

2,285

Invitrogen™ FCGRT Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P13599, P55899, Q61559
Isotype	IgG
Concentration	2.55 mg/mL
Antigen	FCGRT
Gene Symbols	FCGRT
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	alpha-chain; Fc fragment of IgG receptor and transporter; Fc fragment of IgG, receptor, transporter, alpha; Fc receptor, IgG, alpha chain transporter; FCGRT; FCRN; FcRn alpha chain; heavy chain of the major histocompatibility complex class I-like Fc receptor; IgG Fc fragment receptor transporter alpha chain; IgG receptor FcRn large subunit p51; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; neonatal Fc receptor; neonatal Fc-receptor for Ig; transmembrane alpha chain of the neonatal receptor
Gene	FCGRT
Product Type	Antibody
Gene ID (Entrez)	14132, 2217, 29558
Formulation	PBS with 50% glycerol and 0.09% sodium azide; pH 7.3
Immunogen	Recombinant protein (or fragment).
Classification	Polyclonal
Primary or Secondary	Primary

2,286

DNAM-1 (CD226) Mouse anti-Human, PE, Clone: 11A8, BD Pharmingen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze. The monoclonal antibody was purified from tissue culture supernatant or ascites by affinity chromatography. The antibody was conjugated to the dye under optimum conditions and unconjugated antibody and free dye were removed.
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Antigen	DNAM-1 (CD226)
Regulatory Status	RUO
Gene Alias	DNAM-1; DNAM1; PTA1; TLiSA1
Formulation	Aqueous buffered solution containing BSA and ≤0.09% sodium azide.
Immunogen	Human NK Cells
Classification	Monoclonal
Primary or Secondary	Primary
Clone	11A8

2,287

Invitrogen™ PDE4D Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P14270, Q01063, Q08499
Isotype	IgG
Concentration	500 μg/mL
Antigen	PDE4D
Gene Symbols	Pde4d
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	9630011N22Rik; ACRDYS2; cAMP-specific 3',5'-cyclic phosphodiesterase 4D; cAMP-specific phosphodiesterase 4D; cAMP-specific phosphodiesterase PDE4D; cAMP-specific phosphodiesterase PDE4D6; cAMP-specific phosphodiesterase splice variant PDE4D8; cyclic AMP specific phosphodiesterase PDE4D5A; DKFZp686M11213; Dpde3; dunce; FLJ97311; HGNC:8783; HS PDE4DN2; HSPDE4D; PDE43; Pde4d; PDE4D3; PDE4D7; PDE4DN2; phosphodiesterase 4D; Phosphodiesterase 4D cAMP-specific (dunce; phosphodiesterase 4D, cAMP specific; phosphodiesterase 4D, cAMP-specific; Phosphodiesterase 4D, cAMP-specific (dunce; phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila); STRK1; testicular tissue protein Li 136
Gene	Pde4d
Product Type	Antibody
Gene ID (Entrez)	238871, 24627, 5144
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	E. coli-derived human PDE4D recombinant protein (Position: H466-Q709).
Classification	Polyclonal
Primary or Secondary	Primary

2,288

anti-CD4; Clone: GK1.5; BD

Pricing & Availability

2,289

Invitrogen™ REG1B Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P48304
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	REG1B
Gene Symbols	REG1B
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography, Protein A
Gene Alias	lithostathine 1 beta; lithostathine-1-beta; Pancreatic stone protein 2; PSP-2; PSPS2; REG1B; REG-1-beta; regenerating family member 1 beta; regenerating islet-derived 1 beta; regenerating islet-derived 1 beta (pancreatic stone protein, pancreatic thread protein); regenerating islet-derived protein 1-beta; Regenerating protein I beta; REGH; REGI-BETA; REGL; secretory pancreatic stone protein 2
Gene	REG1B
Product Type	Antibody
Gene ID (Entrez)	5968
Formulation	PBS with 50% glycerol and 0.05% ProClin 300; pH 7.4
Immunogen	Recombinant protein Regenerating Islet Derived Protein 1 Beta. The antigen corresponds to amino acid range 23-166 of the target protein.
Classification	Polyclonal
Primary or Secondary	Primary

2,290

Invitrogen™ REG1B Recombinant Rabbit Monoclonal Antibody (008)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA
Form	Liquid
Gene Accession No.	P48304
Isotype	IgG
Concentration	1 mg/mL
Antigen	REG1B
Gene Symbols	REG1B
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	lithostathine 1 beta; lithostathine-1-beta; Pancreatic stone protein 2; PSP-2; PSPS2; REG1B; REG-1-beta; regenerating family member 1 beta; regenerating islet-derived 1 beta; regenerating islet-derived 1 beta (pancreatic stone protein, pancreatic thread protein); regenerating islet-derived protein 1-beta; Regenerating protein I beta; REGH; REGI-BETA; REGL; secretory pancreatic stone protein 2
Gene	REG1B
Product Type	Antibody
Gene ID (Entrez)	5968
Formulation	PBS with no preservative
Immunogen	Recombinant Human REG1B Protein (Met1-Asn166).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	008

2,291

Invitrogen™ Tyrosine Hydroxylase Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P04177, P07101, P24529
Isotype	IgG
Concentration	500 μg/mL
Antigen	Tyrosine Hydroxylase
Gene Symbols	TH
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	dystonia 14; DYT14; DYT5b; EC 1.14.16.2; HGNC:11782; Th; TH isoform 3; TH isoform a; th1; TH-4; The; TY3H; TYH; TYH antibody; Tyrosine 3-hydroxylase; tyrosine 3-monooxygenase; tyrosine hydroxylase
Gene	TH
Product Type	Antibody
Gene ID (Entrez)	21823, 25085, 7054
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH).
Classification	Polyclonal
Primary or Secondary	Primary

2,292

TIM-4 Rat anti-Mouse, RY586, Clone: RMT4-54, BD OptiBuild™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze. The monoclonal antibody was purified from tissue culture supernatant or ascites by affinity chromatography. The antibody was conjugated to the dye under optimum conditions that minimize unconjugated dye and antibody.
Target Species	Mouse
Host Species	Rat
Conjugate	RY586
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Concentration	0.2 mg/mL
Antigen	TIM-4
Regulatory Status	RUO
Gene Alias	TIMD-4, SMUCKLER, Tim4, Timd4
Formulation	Aqueous buffered solution containing ≤0.09% sodium azide.
Immunogen	Mouse Tim-4 Recombinant Protein
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RMT4-54

2,293

CD11c Mouse anti-Human, PE-Cy7, Clone: B-ly6, BD

Mouse Monoclonal Antibody

Pricing & Availability

2,294

Invitrogen™ SSEA3 Monoclonal Antibody (MC-631)

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rat
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunocytochemistry
Form	Liquid
Isotype	IgM
Concentration	1 mg/mL
Antigen	SSEA3
Regulatory Status	RUO
Purification Method	Affinity chromatography - MBP
Gene Alias	SSEA-3; stage-specific embryonic antigen 3
Product Type	Antibody
Formulation	Potassium phosphate with 0.15M NaCl, 1mg/mL BSA and 0.05% sodium azide
Immunogen	Fischer rat immunized with 4-8 cell stage mouse embryos.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MC-631

2,295

MICA Mouse anti-Human, BV421, Clone: 159227, BD Biosciences™

Mouse Monoclonal Antibody

Pricing & Availability

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ CYP26A1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ FCGRT Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PDE4D Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ REG1B Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ REG1B Recombinant Rabbit Monoclonal Antibody (008) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Tyrosine Hydroxylase Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SSEA3 Monoclonal Antibody (MC-631) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CYP26A1 Polyclonal Antibody

Invitrogen™ FCGRT Polyclonal Antibody

Invitrogen™ PDE4D Polyclonal Antibody

Invitrogen™ REG1B Polyclonal Antibody

Invitrogen™ REG1B Recombinant Rabbit Monoclonal Antibody (008)

Invitrogen™ Tyrosine Hydroxylase Polyclonal Antibody

Invitrogen™ SSEA3 Monoclonal Antibody (MC-631)