accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,877,115)
Primary Antibody Matched Pairs (7,125)
Protein Interaction Antibody Pairs (1,378)
Protein Phosphorylation Antibody Pairs (73)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (1)
  • (4)
  • (1)

brands

  • (2)
  • (1)
  • (1)
  • (28)
  • (2)
  • (2)
  • (969)
  • (76,943)
  • (14,166)
  • (41)
  • (6)
  • (59,912)
  • (1)
  • (110)
  • (259)
  • (2)
  • (1,310)
  • (575)
  • (2)
  • (1)
  • (11)
  • (1)
  • (1)
  • (24)
  • (1)
  • (4)
  • (4)
  • (1)
  • (13)
  • (1)
  • (1)
  • (2)
  • (24)
  • (3)
  • (4)
  • (2)
  • (1)
  • (10,631)
  • (397)
  • (1)
  • (12)
  • (1)
  • (8)
  • (3)
  • (2)
  • (1)
  • (1)
  • (190)
  • (55)
  • (1)
  • (6)
  • (1)
  • (63)
  • (3)
  • (15)
  • (1)
  • (12)
  • (2)
  • (1)
  • (76)
  • (5)
  • (17)
  • (19)
  • (1)
  • (14,087)
  • (2)
  • (1)
  • (1)
  • (32,198)
  • (83)
  • (468)
  • (2)
  • (1)
  • (11,567)
  • (1)
  • (1)
  • (51)
  • (3,050)
  • (6)
  • (470)
  • (104)
  • (22,741)
  • (1)
  • (4,434)
  • (1)
  • (1)
  • (1)
  • (1)
  • (16,246)
  • (1)
  • (76)
  • (18,947)
  • (139)
  • (203)
  • (3)
  • (2)
  • (62)
  • (1)
  • (1)
  • (2)
  • (28)
  • (5)
  • (1)
  • (3)
  • (10)
  • (415)
  • (2)
  • (13,812)
  • (29)
  • (1)
  • (2)
  • (45)
  • (42)
  • (11,458)
  • (1)
  • (2)
  • (8)
  • (6)
  • (2)
  • (20)
  • (2)
  • (2)
  • (54)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (34)
  • (2)
  • (1)
  • (40)
  • (2)
  • (1)
  • (62)
  • (53)
  • (453)
  • (55)
  • (10)
  • (3)
  • (78)
  • (12)
  • (11)
  • (1,196)
  • (8)
  • (9)
  • (1)
  • (20)
  • (11)
  • (1)
  • (23)
  • (3)
  • (1)
  • (3)
  • (5)
  • (2)
  • (59)
  • (95)
  • (1)
  • (1)
  • (171)
  • (211)
  • (4)
  • (127)
  • (2)
  • (1)
  • (692)
  • (13)
  • (912)
  • (1)
  • (106)
  • (2,102)
  • (114)
  • (2,514)
  • (1)
  • (12)
  • (1)
  • (1)
  • (972)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (122)
  • (1)
  • (63)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (8)
  • (1)
  • (298)
  • (1)
  • (1,815)
  • (2)
  • (1)
  • (1,791)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (6)
  • (16)
  • (1)
  • (23)
  • (11)
  • (12)
  • (2)
  • (1)
  • (2)
  • (2)
  • (143)
  • (33)
  • (1)
  • (41)
  • (1)
  • (19)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (153,742)
  • (54)
  • (2)
  • (3)
  • (3)
  • (133)
  • (1)
  • (1)
  • (9)
  • (1)
  • (118)
  • (1)
  • (2)
  • (4)
  • (191)
  • (1,157)
  • (10)
  • (2)
  • (10)
  • (8)
  • (2)
  • (36)
  • (1)
  • (1)
  • (1)
  • (112)
  • (12,115)
  • (680)
  • (165)
  • (1)
  • (6)
  • (1)
  • (8,396)
  • (1)
  • (16,512)
  • (3)
  • (16)
  • (4)
  • (137)
  • (31)
  • (111)
  • (1)
  • (3)
  • (8)
  • (6)
  • (9)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (12)
  • (1)
  • (1)
  • (30,472)
  • (13)
  • (1)
  • (32)
  • (1)
  • (1)
  • (6)
  • (79)
  • (1)
  • (1)
  • (11)
  • (7)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (24)
  • (40,282)
  • (2)
  • (1)
  • (12,160)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (40)
  • (7)
  • (57)
  • (15)
  • (1,236,027)
  • (3)
  • (1)
  • (5)
  • (16)
  • (4)
  • (1)
  • (28)
  • (548)
  • (1)
  • (11)
  • (2,475)
  • (2)
  • (1)
  • (4)
  • (2)
  • (2)
  • (421)
  • (1)
  • (8)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,426)
  • (136)
  • (1)
  • (1)
  • (1)
  • (554)
  • (26)
  • (19,393)
  • (1)
  • (8)
  • (1)
  • (1)
  • (1,796)
  • (2)
  • (3)
  • (6)
  • (3)
  • (703)
  • (2)
  • (1)
  • (3)
  • (1)
  • (8)
  • (1)
  • (1)
  • (5)
  • (39)
  • (1)
  • (4)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (2,873)
  • (8)
  • (1)
  • (62)
  • (2)
  • (9)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (14)
  • (1)
  • (1)
  • (28)
  • (241)
  • (1)
  • (3)
  • (2)
  • (17)
  • (1)
  • (1)
  • (10)
  • (10)
  • (2)
  • (1)
  • (2)
  • (40)
  • (7)

special interests

  • (154)
  • (13,840)
  • (165,558)
  • (74)
  • (70,543)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (925)
  • (1,939)
  • (4,412)
Show all

Conjugate

  • (3)
  • (3)
  • (31,161)
  • (9)
  • (1)
  • (29)
  • (2,893)
Show all

Host Species

  • (564)
  • (2,895)
  • (51)
  • (1)
  • (15)
  • (1,780)
  • (726)
Show all

Applications

  • (571)
  • (2)
  • (36)
  • (23)
  • (187)
  • (1,232)
  • (3)
Show all

Target Species

  • (74)
  • (3)
  • (3)
  • (90)
  • (40)
  • (106)
  • (494)
Show all

Classification

  • (81)
  • (105)
  • (885,872)
  • (3,641)
  • (5)
  • (754,521)
  • (30,405)
Show all

Regulatory Status

  • (336)
  • (964)
  • (1,642,883)

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Form

  • (2,701)
  • (2,159)
  • (1,630)
  • (14)
  • (9)
  • (21)
  • (424,939)
Show all

Molecular Weight (g/mol)

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
Show all

Search Within Results
Keyword Search:
331 – 345 of 1,807,464 results
331

CD3e Monoclonal Antibody (145-2C11), Brilliant Violet™ 711, eBioscience™, Invitrogen™
GREENER_CHOICE

Armenian Hamster Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Armenian Hamster
Conjugate Brilliant Violet 711
Applications Flow Cytometry
Form Liquid
Isotype IgG
Gene Accession No. P04235, P11942, P22646, P24161
Concentration 0.2 mg/mL
Antigen CD3e
Gene Symbols Cd247, Cd3d, CD3E, CD3g
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 4930549J05Rik; A430104F18Rik; AI504783; antigen CD3D, delta polypeptide (TiT3 complex); antigen CD3E, epsilon polypeptide (TiT3 complex); antigen CD3G, gamma polypeptide; antigen CD3Z, zeta polypeptide; AW552088; Cd247; CD247 antigen; CD247 antigen, zeta subunit; Cd247 molecule; CD3; CD3 antigen delta chain; CD3 antigen delta polypeptide; CD3 antigen gamma chain; CD3 antigen, delta polypeptide; CD3 antigen, delta subunit; CD3 antigen, epsilon polypeptide; CD3 antigen, gamma polypeptide; CD3 antigen, zeta polypeptide; CD3 delta; CD3 epsilon; CD3 epsilon chain; CD3 epsilon subunit; CD3 epsilon subunit precursor; CD3 gamma-chain; CD3 glycoprotein; CD3 glycoprotein precursor; CD3 molecule delta polypeptide; CD3 molecule, delta; CD3 molecule, epsilon; CD3 molecule, epsilon polypeptide; CD3 molecule, gamma; CD3 molecule, gamma polypeptide; CD3 protein; CD3 TCR complex; CD3 type I transmembrane glycoprotein; CD3 type I transmembrane glycoprotein precursor; CD3 zeta chain; Cd3d; CD3D antigen delta; CD3D antigen, delta polypeptide (TiT3 complex); CD3d molecule; CD3d molecule, delta (CD3-TCR complex); CD3-DELTA; Cd3e; CD3E antigen, epsilon polypeptide; CD3E antigen, epsilon polypeptide (TiT3 complex); CD3e molecule; CD3e molecule, epsilon (CD3-TCR complex); CD3epsilon; CD3-epsilon; Cd3-eta; Cd3g; CD3G antigen, gamma polypeptide; CD3g antigen, gamma polypeptide (TiT3 complex); CD3g molecule; CD3g molecule, epsilon (CD3-TCR complex); CD3g molecule, gamma (CD3-TCR complex); CD3-GAMMA; Cd3h; CD3Q; Cd3z; CD3Z antigen, zeta polypeptide (TiT3 complex); Cd3zeta; Cd3-zeta; CD3zeta chain; CD3-zeta/eta; Ctg3; Ctg-3; FLJ18683; IMD17; IMD18; IMD19; IMD25; Leu-4; OKT3, delta chain; T cell antigen receptor complex epsilon subunit of T3; T3/TCR complex; T3d; T3e; T3g; T3Z; T-cell antigen receptor complex, epsilon subunit of T3; T-cell antigen receptor complex, gamma subunit of T3; T-cell antigen receptor complex, zeta subunit of CD3; T-cell receptor CD3 epsilon chain; T-cell receptor CD3 epsilon subunit; T-cell receptor CD3 subunit zeta; T-cell receptor CD3, subunit zeta; T-cell receptor T3 delta chain; T-cell receptor T3 eta chain; T-cell receptor T3 gamma chain; T-cell receptor T3 zeta chain; T-cell receptor zeta chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 delta chain; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface glycoprotein CD3 gamma chain; T-cell surface glycoprotein CD3 zeta chain; T-cell surface protein; TcR CD3 delta-chain; TcR CD3 gamma-chain; TCR zeta chain; TCR zeta chain subunit; TCRE; Tcrk; TCRZ; TCRzeta; TiT3 complex; type I transmembrane protein; T-cell surface molecule CD3
Gene ID (Entrez) 12500, 12501, 12502, 12503
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 145-2C11
332

CD154 (CD40 Ligand) Monoclonal Antibody (24-31), PE-Cyanine7, eBioscience™, Invitrogen™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Cynomolgus Monkey,Human
Host Species Mouse
Conjugate PE-Cyanine7
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Gene Accession No. P29965
Concentration 5 μL/Test
Antigen CD154 (CD40 Ligand)
Gene Symbols CD40LG
Regulatory Status RUO
Purification Method Affinity chromatography
Gene CD40LG
Product Type Antibody
Gene ID (Entrez) 102138630, 959
Classification Monoclonal
Primary or Secondary Primary
Clone 24-31
333

Invitrogen™ CRB1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form Lyophilized
Gene Accession No. P82279, Q8VHS2
Isotype IgG
Concentration 500 μg/mL
Antigen CRB1
Gene Symbols CRB1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias CRB1; crumbs 1, cell polarity complex component; crumbs family member 1, photoreceptor morphogenesis associated; Crumbs homolog 1; LCA8; Protein crumbs homolog 1; RP12
Gene CRB1
Product Type Antibody
Gene ID (Entrez) 170788, 23418, 304825
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen A synthetic peptide corresponding to a sequence of human CRB1 (FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ).
Classification Polyclonal
Primary or Secondary Primary
334

Invitrogen™ DRD1 Recombinant Superclonal™ Antibody (2HCLC)

Rabbit Recombinant Superclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P21728
Isotype IgG
Concentration 0.5 mg/mL
Antigen DRD1
Gene Symbols DRD1
Regulatory Status RUO
Purification Method Protein A
Gene Alias C030036C15Rik; D(1A) dopamine receptor; D1 receptor; D1a; D1A dopamine receptor; D1a receptor; DADR; Dopamine 1 receptor; Dopamine D1 receptor; dopamine receptor D1; dopamine receptor D1A; Dopamine-1A receptor; Drd1; Drd-1; Drd1a; G protein-coupled receptor DRD1; Gpcr15
Gene DRD1
Product Type Antibody
Gene ID (Entrez) 1812
Formulation PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen Peptide corresponding to human DRD1 [aa427-aa446].
Classification Recombinant Superclonal
Primary or Secondary Primary
Clone 2HCLC
335

Invitrogen™ ITGB8 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P26012
Isotype IgG
Concentration 1 mg/mL
Antigen ITGB8
Gene Symbols ITGB8
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 4832412O06Rik; integrin beta 8; Integrin beta8; integrin beta-8; integrin subunit beta 8; integrin, beta 8; ITGB8
Gene ITGB8
Product Type Antibody
Gene ID (Entrez) 320910, 3696
Formulation PBS with 50% glycerol and 0.02% sodium azide; pH 7.4
Immunogen A synthesized peptide derived from human ITGB8(Accession P26012), corresponding to amino acid residues Q493-G543.
Classification Polyclonal
Primary or Secondary Primary
336

Invitrogen™ Syndecan 4 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage -20°C
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Gene Accession No. P31431
Isotype IgG
Concentration 0.25 mg/mL
Antigen Syndecan 4
Gene Symbols Sdc4
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias AA959608; Amphiglycan; AW108331; MGC22217; RATRYUDOCA; RYUDOCA; ryudocan; ryudocan amphiglycan; ryudocan core protein; Ryudocan/syndecan 4; S4; SDC4; Synd4; syndecan 4; syndecan 4 (amphiglycan, ryudocan); syndecan proteoglycan 4; syndecan-4
Gene Sdc4
Product Type Antibody
Gene ID (Entrez) 6385
Formulation PBS with 0.1% sodium azide; pH 7.4
Immunogen Synthetic peptide derived from the middle region of the human Syndecan-4 protein.
Classification Polyclonal
Primary or Secondary Primary
337

Invitrogen™ Acetyl-p53 (Lys382) Recombinant Superclonal™ Antibody (10HCLC)

Rabbit Recombinant Superclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications ChIP Assay,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P02340, P04637
Isotype IgG
Concentration 0.5 mg/mL
Antigen Acetyl-p53 (Lys382)
Gene Symbols Tp53, Trp53
Regulatory Status RUO
Purification Method Protein A
Gene Alias Antigen NY-CO-13; bbl; BCC7; bfy; bhy; cellular tumor antigen p53; Cys 51 Stop; EGK_08142; FLJ92943; HGNC11998; I79_002739; LFS1; Li-Fraumeni syndrome; mutant p53; mutant tumor protein 53; OTTMUSP00000006194; p44; p53; p53 cellular tumor antigen; p53 protein; p53 tumor suppressor; p53 tumor suppressor phosphoprotein; phosphoprotein p53; Tp53; tp53.L; transformation related protein 53; transformation-related protein 53; Trp248; Trp53; tumor protein 53; tumor protein p53; tumor protein p53 (Li-Fraumeni syndrome); tumor protein p53 L homeolog; tumor suppressor p53; tumor suppressor p53 phosphoprotein; tumor suppressor protein p53; tumor supressor p53; Tumour Protein p53; XELAEV_180196761mg; Xp53; Xrel3
Gene Tp53
Product Type Antibody
Gene ID (Entrez) 22059, 7157
Formulation PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen Acetylated peptide corresponding to amino acids 379-385 of human Tumor Protein 53 [AcK382].
Classification Recombinant Superclonal
Primary or Secondary Primary
Clone 10HCLC
338

IL-10 Monoclonal Antibody (JES5-16E3), Functional Grade, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C
Target Species Mouse
Host Species Rat
Conjugate Functional Grade
Form Liquid
Isotype IgG2b κ
Gene Accession No. P18893
Concentration 1 mg/mL
Antigen IL-10
Regulatory Status RUO
Purification Method Affinity chromatography
Product Type Antibody
Gene ID (Entrez) 16153
Formulation PBS with no preservative; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone JES5-16E3
339

Invitrogen™ EDG2 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse,Rat,Frog
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Liquid
Gene Accession No. P61793, P61794, Q92633
Isotype IgG
Concentration 1 mg/mL
Antigen EDG2
Gene Symbols LPAR1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias AI326300; Edg2; edg-2; endothelial differentiation lysophosphatidic acid G-protein-coupled receptor 2; endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 2; Gpcr26; Gpcr91; GPR26; G-protein coupled receptor 26; Kdt2; LPA receptor 1; LPA1; LPA-1; LPAR1; Lysophosphatidic acid receptor 1; lysophosphatidic acid receptor Edg-2; Mrec1.3; rec.1.3; rec1.3; ventricular zone gene 1; Vzg1; vzg-1
Gene LPAR1
Product Type Antibody
Gene ID (Entrez) 116744, 14745, 1902
Formulation PBS with 1 mg/mL BSA and 0.05% sodium azide
Immunogen Synthetic peptide corresponding to residues L(348) N H T I L A G V H S N D H S V V(364) of human LPA1.
Classification Polyclonal
Primary or Secondary Primary
340

CD127 Monoclonal Antibody (eBioRDR5), FITC, eBioscience™, Invitrogen™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate FITC
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Gene Accession No. P16871
Concentration 5 μL/Test
Antigen CD127
Gene Symbols Il7r
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias CD127; CD127 antigen; CDW127; IL 7 receptor; IL 7R a; IL 7R subunit alpha; IL 7R α; IL 7Ra; IL 7Rα; IL7 receptor; IL-7 receptor alpha chain; IL7 receptor subunit alpha; IL-7 receptor subunit alpha; IL7R; IL-7R; IL7R a; IL7R alpha; IL7R subunit alpha; IL-7R subunit alpha; IL7R α; IL7RA; IL-7RA; IL-7Ralpha; IL-7R-alpha; IL7Rα; ILRA; interleukin 7 receptor; interleukin 7 receptor alpha chain; interleukin 7 receptor isoform H5-6; Interleukin7 receptor subunit alpha; interleukin-7 receptor subunit alpha; MGC107557; sCD127; soluble IL 7 receptor; soluble IL 7R
Gene Il7r
Product Type Antibody
Gene ID (Entrez) 3575
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone eBioRDR5
341

CD11c Monoclonal Antibody (3.9), PE, eBioscience™, Invitrogen™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Gene Accession No. P20702
Concentration 5 μL/Test
Antigen CD11c
Gene Symbols Itgax
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin, alpha X (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6
Gene Itgax
Product Type Antibody
Gene ID (Entrez) 3687
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 3.9
342

Ly-6G Monoclonal Antibody (1A8-Ly6g), Biotin, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, do not freeze
Target Species Mouse
Host Species Rat
Conjugate Biotin
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Gene Accession No. P35461
Concentration 0.5 mg/mL
Antigen Ly-6G
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Gr1; Gr-1; Ly6g; Ly-6G; ly-6G.1; lymphocyte antigen 6 complex, locus G; lymphocyte antigen 6G
Gene Ly6g
Product Type Antibody
Gene ID (Entrez) 546644
Classification Monoclonal
Primary or Secondary Primary
Clone 1A8-Ly6g
343

Invitrogen™ EpCAM Monoclonal Antibody (VU-1D9)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage 4°C
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Immunocytochemistry
Form Liquid
Gene Accession No. P16422
Isotype IgG1 κ
Concentration 0.2 mg/mL
Antigen EpCAM
Gene Symbols EPCAM
Regulatory Status RUO
Purification Method Protein G
Gene Alias adenocarcinoma-associated antigen; CD326; cell surface glycoprotein Trop-1; DIAR5; EGP; EGP-2; EGP314; EGP40; EPCAM; Ep-CAM; EpCAM1; epithelial cell adhesion molecule; Epithelial cell surface antigen; Epithelial glycoprotein; Epithelial glycoprotein 314; ESA; GA733-2; gp40; hEGP314; HNPCC8; human epithelial glycoprotein-2; KS 1/4 antigen; KS1/4; KSA; Ly74; lymphocyte antigen 74; M1S2; M4S1; major gastrointestinal tumor-associated protein GA733-2; mEGP314; membrane component, chromosome 4, surface marker (35kD glycoprotein); MIC18; MK-1; panepithelial glycoprotein 314; protein 289A; Protein D5.7A; Tacsd1; Tacstd1; TROP1; Trop-1 protein; Tumor-associated calcium signal transducer 1
Gene EPCAM
Product Type Antibody
Gene ID (Entrez) 4072
Formulation PBS with 0.2% BSA and 0.09% sodium azide; pH 7.4
Immunogen Small cell lung carcinoma cells.
Classification Monoclonal
Primary or Secondary Primary
Clone VU-1D9
344

CD1d Monoclonal Antibody (1B1), eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C
Target Species Mouse
Host Species Rat
Conjugate Unconjugated
Applications Flow Cytometry,Functional Assay,Immunohistochemistry,Immunoprecipitation
Form Liquid
Isotype IgG2b κ
Gene Accession No. P11609
Concentration 0.5 mg/mL
Antigen CD1d
Gene Symbols Cd1d1
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Cd1d1
Product Type Antibody
Gene ID (Entrez) 12479
Classification Monoclonal
Primary or Secondary Primary
Clone 1B1
345

Invitrogen™ H3K4me1 Recombinant Superclonal™ Antibody, ChIP-Verified

Rabbit Recombinant Superclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Peptide Array,ChIP Assay,ChIP sequencing (ChIP-seq),Western Blot,CUT&RUN,Immunocytochemistry
Form Liquid
Gene Accession No. P68431, P68433, P84228, Q71DI3
Isotype IgG
Concentration 0.5 mg/mL
Antigen H3K4me1
Gene Symbols H3C1, H3C10, H3C12, H3C14, H3C15, H3C2, H3C7
Regulatory Status RUO
Purification Method Protein A
Gene Alias B0035.7; CELE_T10C6.12; CG31613; CG31613-PA; CG33803; CG33806; CG33809; CG33812; CG33815; CG33818; CG33821; CG33824; CG33827; CG33830; CG33833; CG33836; CG33839; CG33842; CG33845; CG33848; CG33851; CG33854; CG33857; CG33860; CG33863; CG33866; Dmel\CG31613; Dmel_CG31613; F07B7.10; F07B7.3; F08G2.2; F17E9.13; F35H10.1; F45F2.4; F54E12.5; F55G1.10; H02I12.7; H3; H3 histone; H3 histone family, member A; H3 histone family, member I; H3 histone family, member K; H3 histone family, member L; H3 histone family, member M; H3 histone, family 2; H3 histone, family 3A; H3 histone, family 3B; H3 histone, family 3B (H3.3B); H3 histone, family 3B.1; H3 histone, family 3C; H3 K4; H3.1-221; H3.1-291; H3.1-I; H3.2; H3.2-221; H3.2-614; H3.2-615; H3.2-616; h3.2a; H3.3A; H3.3B; H3.5; H3/A; H3/b; H3/d; H3/f; H3/i; H3/j; H3/k; H3/l; H3/M; H3/n; H3/o; H3-143; H3-291; H3-3A; H3-3b; h3-5; H3-53; H3-614; H3a; H3b; H3-B; H3c1; H3C10; H3c11; H3C12; H3C2; H3C3; H3C4; H3C6; H3C7; H3c8; H3f; H3-F; H3F1K; H3F2; H3F3; h3f3a; H3F3B; h3f3b.1; H3F3C; h3f3d; H3FA; H3FB; H3FC HIST1H3C; H3FD; H3FF; H3FH; H3FI; H3FJ; H3FK; H3FL; H3FM; H3FN; H3g; H3h; H3i; H3K4; H3K4me; H3Lys4me; H3Lys4me1; h3r; his-12; his-16; his-19; his-21; His3; his-3; His3:CG31613; His3:CG31613-PA; His3:CG33803; His3:CG33806; His3:CG33809; His3:CG33812; His3:CG33815; His3:CG33818; His3:CG33821; His3:CG33824; His3:CG33827; His3:CG33830; His3:CG33833; His3:CG33836; His3:CG33839; His3:CG33842; His3:CG33845; His3:CG33848; His3:CG33851; His3:CG33854; His3:CG33857; His3:CG33860; His3:CG33863; His3:CG33866; his-30; his-33; his-43; his-47; his-51; his-53; his-57; his-61; his-65; his-68; his-7; Hist1; Hist1h3a; Hist1h3b; Hist1h3c; HIST1H3D; Hist1h3e; Hist1h3f; Hist1h3g; hist1h3g.L; Hist1h3h; HIST1H3I; HIST1H3J; hist2h3; HIST2H3A; Hist2h3b; HIST2H3C; Hist2h3c1; Hist2h3c2; Hist2h3c2-ps; Hist2h3ca1; Hist2h3ca2; HIST2H3D; histone 1, H3a; histone 1, H3b; histone 1, H3f; histone 1, H3h; histone 2, H3a; histone 2, H3c; histone 2, H3c2; histone 2, H3ca2; Histone 3; histone cluster 1, H3a; histone cluster 1, H3b; histone cluster 1, H3f; histone cluster 1, H3g protein L homeolog; histone cluster 1, H3h; histone cluster 2, H3a; histone cluster 2, H3c; histone cluster 2, H3c2; histone cluster 2, H3c2, pseudogene; histone gene complex 1; Histone H2A; Histone H3; histone H3.1; Histone H3.2; histone H3.3; Histone H3.3C; histone H3.5; Histone H3/a; Histone H3/b; Histone H3/c; Histone H3/d; Histone H3/f; Histone H3/h; Histone H3/i; Histone H3/j; Histone H3/k; histone H3/l; Histone H3/m; histone H3/o; Histone H3K4me1; histone variant H3.5; hypothetical protein LOC550262; K06C4.11; K06C4.3; M32461; methyl Histone 3; methyl Histone H3; Methyl-H3 K4; Methyl-H3 Lys4; Methyl-Histone H3 K4; Methyl-Histone H3 Lys4; Mono-methyl H3; Mono-methyl Histone H3; PP781; T10C6.12; T23D8.6; wu:fa25h06; wu:fa96g06; wu:fb07a08; wu:fb36f01; XELAEV_18028537mg; zgc:110292; zgc:174300; zgc:56193; zgc:56418; zgc:64222; zgc:86731; ZK131.10; ZK131.6
Gene H3C1
Product Type Antibody
Gene ID (Entrez) 126961, 260423, 319150, 319152, 333932, 360198, 8350, 8356, 8357, 8358, 8968, 97114
Formulation PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen Methylated peptide (Lys4) corresponding to human Histone H3 (aa 2-11).
Classification Recombinant Superclonal
Primary or Secondary Primary