Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

4,261 – 4,275 of 1,763,575 results

4,261

CD309 (FLK1) Monoclonal Antibody (Avas12a1), PE, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P35918
Concentration	0.2 mg/mL
Antigen	CD309 (FLK1)
Gene Symbols	KDR
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	6130401C07; CD309; CD309 antigen; fetal liver kinase 1; fetal liver kinase-1; FLK1; Flk-1; FLK1 kinase insert domain receptor (a type III receptor tyrosine kinase) (VEGF receptor 2); FLK1 kinase insert domain receptor (VEGF receptor 2); flk-1 type VEGF receptor; KDR; kinase insert domain protein receptor; kinase insert domain receptor; kinase insert domain receptor (a type III receptor tyrosine kinase); kinase NYK; Krd-1; Ly73; protein-tyrosine kinase receptor flk-1; sCD309; soluble CD309; soluble vascular endothelial growth factor receptor 2; soluble VEGFR 2; soluble VEGFR2; sVEGFR-2; tyrosine kinase growth factor receptor; vascular endotheial growth factor 2; vascular endothelial growth factor receptor 2; vascular endothelial growth factor receptor- 2; vascular endothelial growth factor receptor-2; vascular endothelial growth factor receptor-3; VEGF R2; VEGF receptor-2; VEGFR; VEGFR2; VEGFR-2
Gene	KDR
Product Type	Antibody
Gene ID (Entrez)	16542
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	Avas12a1

4,262

Invitrogen™ CD144 (VE-cadherin) Monoclonal Antibody (16B1), PE, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P33151
Isotype	IgG1
Concentration	0.2 mg/mL
Antigen	CD144 (VE-cadherin)
Gene Symbols	CDH5
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	7B4; 7B4 antigen; 7B4/cadherin-5; AA408225; cadherin 5; cadherin 5, type 2 (vascular endothelium); cadherin 5, type 2, VE-cadherin (vascular endothelium); cadherin 5, type 2, VE-cadherin (vascular epithelium); cadherin-5; cadherin-5; cd144 antigen; VE cadherin; Cd144; cd144 antigen; CDH5; cell-cell adhesion protein; endothelial-specific cadherin; vascular endothelial cadherin; vascular endothelial cadherin precursor; Vec; VEcad; VE-Cad; VE-cadherin; VECD
Gene	CDH5
Product Type	Antibody
Gene ID (Entrez)	1003
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	16B1

4,263

AIRE Monoclonal Antibody (TM-724), eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Rat
Conjugate	Unconjugated
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	O43918
Concentration	0.5 mg/mL
Antigen	AIRE
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	Aire
Product Type	Antibody
Gene ID (Entrez)	326
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TM-724

4,264

Invitrogen™ RAB5A Monoclonal Antibody (2E8B11), eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P20339
Isotype	IgG1 κ
Concentration	0.5 mg/mL
Antigen	RAB5A
Gene Symbols	RAB5A
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	2410015H04Rik; AI663973; AU021172; nnyRab5a; Rab 5; Rab 5A; RAB5; RAB5A; RAB5A, member RAS oncogene family; Ras related protein; RAS-associated protein RAB5A; ras-related protein Rab-5A; Small GTP-binding protein rab5
Gene	RAB5A
Product Type	Antibody
Gene ID (Entrez)	5868
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Purified recombinant fragment of human Rab5a (AA: 1-215) expressed in E. Coli.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2E8B11

4,265

CD45 Monoclonal Antibody (30-F11), Brilliant Ultra Violet™ 615, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Brilliant Ultraviolet 615
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P06800
Concentration	0.2 mg/mL
Antigen	CD45
Gene Symbols	PTPRC
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	B220; cd45; CD45 antigen; CD45 antigen isoform 1 precursor; CD45 antigen isoform 2 precursor; CD45 antigen isoform 3 precursor; CD45 antigen isoform 4 precursor; CD45 antigen isoform 5 precursor; CD45 antigen isoform 6 precursor; CD45R; GP180; Lca; L-CA; leucocyte common antigen; leukocyte common antigen; leukocyte common antigen A; leukocyte common antigen B; leukocyte common antigen, CD45; loc; LOW QUALITY PROTEIN: receptor-type tyrosine-protein phosphatase C; LY5; Ly-5; lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; membrane tyrosine phosphatase; protein tyrosine phosphatase lambda; protein tyrosine phosphatase receptor type C; protein tyrosine phosphatase, receptor type C; protein tyrosine phosphatase, receptor type, C; protein tyrosine phosphatase, receptor type, c polypeptide; Protein tyrosine phosphatase, receptor-type, c polypeptide; protein tyrosine phosphatase; alternatively spliced; Ptprc; Receptor-type tyrosine-protein phosphatase C; RT7; T200; T200 glycoprotein; T200 leukocyte common antigen; T220 and B220
Gene	PTPRC
Product Type	Antibody
Gene ID (Entrez)	19264
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	30-F11

4,266

Invitrogen™ nNOS Monoclonal Antibody (3G6B10)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form	Liquid
Gene Accession No.	P29475, P29476, Q9Z0J4
Isotype	IgG1 κ
Concentration	0.5 mg/mL
Antigen	nNOS
Gene Symbols	NOS1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2310005C01Rik; bNOS; bNOS1; Brain NOS; Constitutive NOS; IHPS1; NC-NOS; neuronal nitric oxide synthase; neuronal nitric oxide synthase NOS1; neuronal NOS; nitric oxidase synthase; nitric oxide synthase; nitric oxide synthase 1; nitric oxide synthase 1 (neuronal); nitric oxide synthase 1, neuronal; nitric oxide synthase, brain; nNOS; N-NOS; nNOS; NOS type I; NO; NOS; NOS Type 1; NOS type I; Nos1; Nos-1; NOS-I; Peptidyl-cysteine S-nitrosylase NOS1; Phospho-bNOS; Phospho-Brain NOS
Gene	NOS1
Product Type	Antibody
Gene ID (Entrez)	18125, 24598, 4842
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	Recombinant protein derived from the N-terminal region of rat nNOS protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	3G6B10

4,267

Invitrogen™ SMAD1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Monkey
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P70340, Q15797
Isotype	IgG
Concentration	0.25 mg/mL
Antigen	SMAD1
Gene Symbols	SMAD1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI528653; BSP1; BSP-1; dwarfin-A; Dwf-A; DWFC; hSMAD1; JV41; JV4-1; JV5-1; MAD (mothers against decapentaplegic, Drosophila) homolog 1; MAD homolog 1; MAD homolog1 (mothers against decapentaplegic, Drosophila); MAD, mothers against decapentaplegic homolog 1; Madh1; MADH5; MADR1; Mad-related protein 1; Mlp1; mMad1; mothers against decapentaplegic homolog 1; mothers against DPP homolog 1; mothers-against-DPP-related 1; Mothers-against-DPP-related-1; MusMLP; OTTHUMP00000220456; SMAD; Smad 1; SMAD family member 1; SMAD, mothers against DPP homolog 1; Smad1; SMAD5; TGF-beta signaling protein 1; transforming growth factor-beta signaling protein 1; Transforming growth factor-beta-signaling protein 1
Gene	SMAD1
Product Type	Antibody
Gene ID (Entrez)	17125, 4086
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	Synthetic peptide derived from an internal region of the human Smad1 protein.
Classification	Polyclonal
Primary or Secondary	Primary

4,268

Invitrogen™ Claudin 15 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Western Blot
Form	Liquid
Gene Accession No.	D3ZQJ0, P56746, Q9Z0S5
Isotype	IgG
Concentration	0.25 mg/mL
Antigen	Claudin 15
Gene Symbols	CLDN15
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	2210009B08Rik; BB107105; claudin 15; claudin-15; CLDN15
Gene	CLDN15
Product Type	Antibody
Gene ID (Entrez)	24146, 304388, 60363
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	Synthetic peptide derived from the C-terminal region of the mouse Claudin-15 protein.
Classification	Polyclonal
Primary or Secondary	Primary

4,269

Invitrogen™ CD328 (Siglec7) Monoclonal Antibody (eBioQA79 (QA79)), PE, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q9Y286
Isotype	IgG1
Concentration	5 μL/Test
Antigen	CD328 (Siglec7)
Gene Symbols	SIGLEC7
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Adhesion inhibitory receptor molecule 1; adhesion inhibitory receptor molecule 1, siglec-7; AIRM1; AIRM-1; CD328; CDw328; D-siglec; p75; p75/ AIRM-1; p75/AIRM1; QA79; QA79 membrane protein; sialic acid binding Ig like lectin 7; sialic acid binding Ig-like lectin 7; sialic acid binding immunoglobulin-like lectin 7; sialic acid-binding Ig-like lectin 7; Siglec; SIGLEC19P; SIGLEC7; SIGLEC-7; SIGLECP2
Gene	SIGLEC7
Product Type	Antibody
Gene ID (Entrez)	27036
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBioQA79 (QA79)

4,270

Invitrogen™ CD169 (Siglec-1) Monoclonal Antibody (7-239), PE, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q9BZZ2
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD169 (Siglec-1)
Gene Symbols	SIGLEC1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Cd169; dJ1009E24.1; macrophage receptor; p210; pSn; SA; SER; sheep erythrocyte receptor; sialic acid binding Ig like lectin 1; sialic acid binding Ig-like lectin 1, sialoadhesin; Sialic acid-binding Ig-like lectin 1; sialic acid-binding immunoglobulin-like lectin 1; sialoadhesin; SIGLEC1; Siglec-1; SN
Gene	SIGLEC1
Product Type	Antibody
Gene ID (Entrez)	6614
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	7-239

4,271

Invitrogen™ Perforin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles, store in dark
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P14222
Isotype	IgG
Concentration	1 mg/mL
Antigen	Perforin
Gene Symbols	PRF1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Cyta; Cytolysin; FLH2; HPLH2; lymphocyte pore forming protein; lymphocyte pore-forming protein; OMAK; OTTHUMP00000019759; P1; perforin 1; perforin 1 (pore forming protein); Perforin1; perforin-1; Pfn; PFN1; Pfp; PGFL; PIGF; PIGF-2; PLGF; pore forming protein; pore-forming protein; PRF1; Prf-1; PRF1 (pore forming protein 1); RATCYTA; RP11-710A11.3
Gene	PRF1
Product Type	Antibody
Gene ID (Entrez)	5551
Formulation	PBS with 50% glycerol, 0.2% BSA and 0.05% sodium azide; pH 7.4
Immunogen	Recombinant protein within Human Perforin aa 306-515.
Classification	Polyclonal
Primary or Secondary	Primary

4,272

Invitrogen™ SARS-CoV-2 Spike Protein S1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Virus
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	1 mg/mL
Antigen	SARS-CoV-2 Spike Protein S1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Coronavirus; COVID; Covid 19; COVID19; COVID-19; SARS; SARS Coronavirus; SARS CoV; SARS CoV2; SARS CoV-2; SARS Spike Protein; SARS-CoV2; SARS-CoV-2
Product Type	Antibody
Formulation	PBS with 0.02% sodium azide
Immunogen	Anti-SARS-CoV-2 (COVID-19) Spike S1 antibody was raised against a peptide corresponding to 16 amino acids near the aminoterminus of SARS-CoV-2 (COVID-19) Spike S1 glycoprotein. The immunogen is located within the first 50 amino acids of SARS-CoV-2 (COVID-19) Spike S1 protein.
Classification	Polyclonal
Primary or Secondary	Primary

4,273

Invitrogen™ MHC Class II (I-Ab) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P01921, P06342, P06343, P06344, P06345, P06346, P14483
Isotype	IgG
Concentration	1.8 mg/mL
Antigen	MHC Class II (I-Ab)
Gene Symbols	H2-Ab1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Abeta; AI845868; CELIAC1; DADB-249P12.2; H-2 class II histocompatibility antigen, A beta chain; H-2Ab; H2-Ab; H2-Ab1; H2Eb; H-2Eb; H2-iabeta; histocompatibility 2, class II antigen A, beta 1; HLA-DQB; Ia2; Ia-2; Ia4; Ia-4; IAb; I-Abeta; IDDM1; major histocompatibility complex class II beta chain; MGC163794; MGC163796; MHC class II antigen A beta; MHC class II H2-IA-beta-psi; response to metastatic cancers 1; Rmcs1
Gene	H2-Ab1
Product Type	Antibody
Gene ID (Entrez)	14961
Formulation	PBS with 50% glycerol and 0.05% ProClin 300; pH 7.3
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-219 of mouse H2-Ab1 (NP_9969882).
Classification	Polyclonal
Primary or Secondary	Primary

4,274

Invitrogen™ Filaggrin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Liquid
Gene Accession No.	P11088, P20930
Isotype	IgG
Concentration	2.45 mg/mL
Antigen	Filaggrin
Gene Symbols	FLG
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	ATOD2; AW107830; epidermal filaggrin; filaggrin; Filaggrin (profilaggrin); FLG; ft; Pflg
Gene	FLG
Product Type	Antibody
Gene ID (Entrez)	14246, 2312, 24641
Formulation	PBS with 50% glycerol and 0.05% ProClin 300; pH 7.3
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human FLG (NP_0020071).
Classification	Polyclonal
Primary or Secondary	Primary

4,275

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	P37173
Isotype	IgG2b
Concentration	500 μg/mL
Antigen	TGFBR2
Gene Symbols	TGFBR2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1110020H15Rik; AAT3; AU042018; DNIIR; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; RIIDN; TAAD2; TbetaRII; TbetaR-II; TBR-II; tgf beta receptor 2; TGF-beta 2; TGF-beta receptor II; TGF-beta receptor type II; TGF-beta receptor type IIB; TGF-beta receptor type-2; TGFbeta RII; TGFbeta type II receptor; TGF-beta type II receptor; TGFbeta-RII; TGFBR2; Tgfbr2T; TGFR2; TGFR-2; transforming growth factor beta receptor 2; transforming growth factor beta receptor II; transforming growth factor beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor 2; transforming growth factor, beta receptor II; transforming growth factor, beta receptor II (70/80kDa); transforming growth factor, beta receptor II alpha; transforming growth factor, beta receptor II beta; transforming growth factor, beta receptor II delta; transforming growth factor, beta receptor II epsilon; transforming growth factor, beta receptor II gamma; transforming growth factor, beta receptor IIT; transforming growth factor-b type II receptor; transforming growth factor-beta receptor type II; transforming growth factor-beta type II receptor
Gene	TGFBR2
Product Type	Antibody
Gene ID (Entrez)	7048
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2F11

Primary Antibodies

Filtered Search Results

Narrow Results

CD309 (FLK1) Monoclonal Antibody (Avas12a1), PE, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD144 (VE-cadherin) Monoclonal Antibody (16B1), PE, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

AIRE Monoclonal Antibody (TM-724), eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RAB5A Monoclonal Antibody (2E8B11), eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD45 Monoclonal Antibody (30-F11), Brilliant Ultra Violet™ 615, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ nNOS Monoclonal Antibody (3G6B10) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SMAD1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Claudin 15 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD328 (Siglec7) Monoclonal Antibody (eBioQA79 (QA79)), PE, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD169 (Siglec-1) Monoclonal Antibody (7-239), PE, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Perforin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SARS-CoV-2 Spike Protein S1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MHC Class II (I-Ab) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Filaggrin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD309 (FLK1) Monoclonal Antibody (Avas12a1), PE, eBioscience™, Invitrogen™

Invitrogen™ CD144 (VE-cadherin) Monoclonal Antibody (16B1), PE, eBioscience™

AIRE Monoclonal Antibody (TM-724), eBioscience™, Invitrogen™

Invitrogen™ RAB5A Monoclonal Antibody (2E8B11), eBioscience™

CD45 Monoclonal Antibody (30-F11), Brilliant Ultra Violet™ 615, eBioscience™, Invitrogen™

Invitrogen™ nNOS Monoclonal Antibody (3G6B10)

Invitrogen™ SMAD1 Polyclonal Antibody

Invitrogen™ Claudin 15 Polyclonal Antibody

Invitrogen™ CD328 (Siglec7) Monoclonal Antibody (eBioQA79 (QA79)), PE, eBioscience™

Invitrogen™ CD169 (Siglec-1) Monoclonal Antibody (7-239), PE, eBioscience™

Invitrogen™ Perforin Polyclonal Antibody

Invitrogen™ SARS-CoV-2 Spike Protein S1 Polyclonal Antibody

Invitrogen™ MHC Class II (I-Ab) Polyclonal Antibody

Invitrogen™ Filaggrin Polyclonal Antibody

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11)