Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

5,911 – 5,925 of 1,824,201 results

5,911

Invitrogen™ COX4 Monoclonal Antibody (IB52C31H10), eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P10888, P13073, P19783
Isotype	IgG1 κ
Concentration	0.5 mg/mL
Antigen	COX4
Gene Symbols	COX4I1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AL024441; C16orf2; C16orf4; COX; cox iv; COX IV-1; Cox IV-2; Cox4; COX4 neighbor; Cox4-1; COX4-2; Cox4a; COX4AL; Cox4b; COX4I1; cox4i1.S; Cox4i2; COX4L2; COX4NB; coxiv; COXIV-1; CoxIV-2; cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit 4 isoform 1, mitochondrial; cytochrome c oxidase subunit 4 isoform 2, mitochondrial; cytochrome c oxidase subunit 4I1; cytochrome c oxidase subunit 4I2; cytochrome c oxidase subunit IV; cytochrome c oxidase subunit IV isoform 1; cytochrome c oxidase subunit IV isoform 1 precursor; cytochrome c oxidase subunit IV isoform 1 S homeolog; cytochrome c oxidase subunit IV isoform 2; cytochrome c oxidase subunit IV isoform 2 (lung); cytochrome c oxidase subunit IV precursor EC 1.9.3.1; cytochrome c oxidase subunit IV-like 2; cytochrome c oxidase, subunit 4a; cytochrome c oxidase, subunit 4b; cytochrome c oxidase, subunit IV; cytochrome c oxidase, subunit IVa; cytochrome c oxidase, subunit IVb; cytochrome c oxydase subunit 4; dJ857M17.2; EMC8; ER membrane protein complex subunit 8; FAM158B; family with sequence similarity 158, member B; FLJ23483; hypothetical protein MGC73355; IV-1; mg:bb02d03; MGC72016; Neighbor of COX4; NOC4; Protein FAM158B; XELAEV_18024950mg; zgc:110058; zgc:73355
Gene	COX4I1
Product Type	Antibody
Gene ID (Entrez)	12857, 1327, 29445
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	IB52C31H10

5,912

Invitrogen™ EphB1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P09759, P54762, Q8CBF3
Isotype	IgG
Concentration	500 μg/mL
Antigen	EphB1
Gene Symbols	EPHB1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	9330129L11; AW488255; C130099E04Rik; Cek6; EK6; ELK; Elkh; ELK-related protein tyrosine kinase; ENSMUSG00000074119; Eph receptor B1; Eph receptor B2 (ELK-related protein tyrosine kinase); eph tyrosine kinase 2; EPHB1; Ephb2; EPH-like kinase 6; Ephrin type-B receptor 1; EPHT2; Epth2; Erk; Hek6; NET; Neuronally-expressed EPH-related tyrosine kinase; soluble EPHB1 variant 1; tyrosine-protein kinase receptor EPH-2
Gene	EPHB1
Product Type	Antibody
Gene ID (Entrez)	2047, 24338, 270190
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE).
Classification	Polyclonal
Primary or Secondary	Primary

5,913

Invitrogen™ ATG12 Recombinant Rabbit Monoclonal Antibody (20H24L24)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O94817, Q2TBJ5, Q9CQY1
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	ATG12
Gene Symbols	ATG12
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	4931423H11Rik; A330058M13Rik; APG 12; APG12; Apg12 (autophagy, yeast) homolog; APG12L; APG12-like; ATG12; ATG12 autophagy related 12 homolog; Atg12l; Atg12p; Atg12-PB; Autophagy protein 12-like; autophagy related 12; autophagy related protein 12; autophagy-related 12; autophagy-related protein 12; Autophagy-specific gene 12; CG10861; CG10861-PB; Dmel\CG10861; Dmel_CG10861; FBR93; HAPG12; IP05205p; IP05405p; OTTHUMP00000159129; ubiquitin-like protein ATG12; YBR1506; YBR217W
Gene	ATG12
Product Type	Antibody
Gene ID (Entrez)	361321, 67526, 9140
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptides corresponding to Human ATG12 (aa 43-μ, 122-133).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	20H24L24

5,914

IL-6 Monoclonal Antibody (MP5-20F3), FITC, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	FITC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P08505
Concentration	0.5 mg/mL
Antigen	IL-6
Gene Symbols	Il6
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	B-cell differentiation factor; B-cell hybridoma growth factor; B-cell stimulatory factor 2; BSF2; BSF-2; CDF; CHIL-6; CTL differentiation factor; cytokine; HGF; H-IL-6; HSF; hybridoma growth factor; Ifnb2; IFN-beta-2; Il6; IL-6; ILg6; ILN; interferon beta-2; Interleukin; interleukin 6; Interleukin 6 (interferon, beta 2); interleukin 6 precursor; interleukin BSF-2; interleukin HP-1; Interleukin6; Interleukin-6; interleukin-6 precursor; interleukin-6 protein; M-IL-6; prointerleukin 6; R-IL-6
Gene	Il6
Product Type	Antibody
Gene ID (Entrez)	16193
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MP5-20F3

5,915

Invitrogen™ SOS2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	Q07890
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	SOS2
Gene Symbols	SOS2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	mSOS-2; NS9; son of sevenless 1; son of sevenless homolog 2; son of sevenless homolog 2 (Drosophila); SOS Ras/Rho guanine nucleotide exchange factor 2; Sos1; Sos2; SOS-2
Gene	SOS2
Product Type	Antibody
Gene ID (Entrez)	6655
Formulation	PBS with 30% glycerol, 0.1% BSA and 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptides corresponding to human SOS2 [1) aa1152-aa1170 2) aa1184-aa1203].
Classification	Polyclonal
Primary or Secondary	Primary

5,916

Invitrogen™ TdT Monoclonal Antibody (19-3), APC, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P04053, P09838
Isotype	IgG2b κ
Concentration	0.2 mg/mL
Antigen	TdT
Gene Symbols	DNTT
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Deoxynucleotidyltransferase terminal; deoxynucleotidyltransferase, terminal; DNA nucleotidylexotransferase; Dntt; Nucleosidetriphosphate DNA Deoxynucleotidylexotransferase; nucleosidetriphosphate:DNA deoxynucleotidylexotransferase; TDT; Terminal addition enzyme; terminal deoxynucleotidyl transferase; terminal deoxynucleotidyltransferase; terminal deoxyribonucleotidyltransferase; terminal transferase
Gene	DNTT
Product Type	Antibody
Gene ID (Entrez)	1791, 21673
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	19-3

5,917

Invitrogen™ H4K20ac Recombinant Rabbit Monoclonal Antibody (RM205), ChIP-Verified

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Yeast
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ChIP Assay,ELISA,Western Blot,Luminex,Immunocytochemistry
Form	Liquid
Gene Accession No.	P62805
Isotype	IgG
Concentration	1 mg/mL
Antigen	H4K20ac
Gene Symbols	H4-16, H4C1, H4C11, H4C14, H4C2, H4C5, H4C9
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	acetyl Histone H4; Acetyl-H4 K20; Acetyl-H4 Lys20; Acetyl-Histone H4 K20; Acetyl-Histone H4 Lys20; FO108; H4; H4 histone family, member A; H4 histone family, member I; H4 histone family, member J; H4 histone family, member M; H4 histone family, member N; H4 histone, family 2; H4 K20ac; H4/A; H4/B; H4/C; H4/D; H4/E; H4/G; H4/H; H4/I; H4/j; H4/K; H4/M; H4/n; H4/O; H4/p; H4-16; H4C1; H4C11; H4C12; H4C13; H4C14; H4C15; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FA; H4FB; H4FC; H4FD; H4FE; H4FG; H4FH; H4FI; H4FJ; H4FK; H4FM; H4FN; H4FO; H4K20; H4K20a; H4Lys20ac; H4M; HIST1H4; HIST1H4A; HIST1H4B; HIST1H4C; HIST1H4D; HIST1H4E; HIST1H4F; HIST1H4H; HIST1H4I; HIST1H4J; HIST1H4K; HIST1H4L; HIST2H4; HIST2H4A; HIST2H4B; HIST4H4; histone 1, H4a; histone 1, H4b; histone 1, H4e; histone 1, H4i; histone 2, H4a; Histone 4; Histone 4 family, member M; histone 4, H4; histone cluster 1, H4a; histone cluster 1, H4b; histone cluster 1, H4e; histone cluster 1, H4i; histone cluster 2, H4a; Histone Cluster 4; histone cluster 4, H4; histone family member; histone H4; Histone H4 acetyl; Histone H4A; Histone H4K20; Histone H4K20ac; histone IV, family 2
Gene	H4C1
Product Type	Antibody
Gene ID (Entrez)	121504, 8294, 8359, 8363, 8366, 8367, 8370
Formulation	PBS with 50% glycerol, 1% BSA and 0.09% sodium azide
Immunogen	An acetyl-peptide corresponding to Acetyl-Histone H4 (Lys20).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	RM205

5,918

Invitrogen™ Galectin 9 Monoclonal Antibody (9M1-3), eFluor™ 660, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	eFluor 660
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O00182
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	Galectin 9
Gene Symbols	Lgals9
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	36 kDa beta-galactoside-binding lectin; AA407335; AI194909; AI265545; ecalectin; Gal9; gal-9; galectin 9; Galectin9; galectin-9; HOM HD 21; HUAT; Lectin galactose binding soluble 9 (Galectin-9); lectin, galactose binding, soluble 5; lectin, galactose binding, soluble 9; Lectin, galactose binding, soluble 9 (Galectin-9); lectin, galactoside binding soluble 9; lectin, galactoside-binding, soluble, 9; LGALS35; Lgals5; LGALS9; LGALS9A; tumor antigen HOM-HD-21; UAT; urate transporter/channel; urate transporter/channel protein
Gene	Lgals9
Product Type	Antibody
Gene ID (Entrez)	3965
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	9M1-3

5,919

LRP8 Recombinant Rabbit Monoclonal Antibody (23GB2520), Invitrogen™

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Gene Accession No.	Q14114, Q924X6
Antigen	LRP8
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	4932703M08Rik; AA921429; AI848122; ApoE receptor 2; APOER2; Apolipoprotein E receptor 2; HSZ75190; LDL receptor related protein 8; low density lipoprotein receptor relative, 8 ligand binding repeats, brain; low density lipoprotein receptor-related protein 8, apolipoprotein e receptor; low-density lipoprotein receptor-related protein 8; Lr8b; Lrp8; LRP-8; MCI1; Protein LR8B
Gene	LRP8
Product Type	Antibody
Gene ID (Entrez)	16975, 362558, 7804
Formulation	PBS with 50% glycerol and 0.02% sodium azide; pH 7.4
Immunogen	A synthesized peptide derived from human ApoER2 (900-963AA).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	23GB2520

5,920

CD154 (CD40 Ligand) Monoclonal Antibody (MR1), Alexa Fluor™ 488, eBioscience™, Invitrogen™

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Armenian Hamster
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG
Gene Accession No.	P27548
Concentration	0.5 mg/mL
Antigen	CD154 (CD40 Ligand)
Regulatory Status	RUO
Product Type	Antibody
Gene ID (Entrez)	21947
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MR1

5,921

CD19 Monoclonal Antibody (6OMP31), Biotin, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse,Rat
Host Species	Rat
Conjugate	Biotin
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P15391, P25918
Concentration	0.5 mg/mL
Antigen	CD19
Gene Symbols	Cd19
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AW495831; B4; B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; Cd19; CD19 antigen; CD19 molecule; CVID3; differentiation antigen CD19; Leu-12; T-cell surface antigen Leu-12
Gene	Cd19
Product Type	Antibody
Gene ID (Entrez)	12478, 365367, 930
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	6OMP31

5,922

Invitrogen™ HBEGF Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	Q06175, Q06186, Q99075
Isotype	IgG
Concentration	500 μg/mL
Antigen	HBEGF
Gene Symbols	HBEGF
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AW047313; Diphtheria toxin receptor; Diphtheria toxin receptor (heparin binding epidermal growth factor - like growth factor); diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); DTR; DT-R; DTS; DTSF; GFHB; hb egf; HBEGF; Hb-egf; Hegfl; heparin binding EGF like growth factor; heparin binding epidermal growth factor-like growth factor; heparin-binding EGF-like growth factor; heparin-binding epidermal -growth - like growth factor; heparin-binding epidermal growth factor; heparin-binding epidermal -growth factor; proheparin-binding EGF-like growth factor
Gene	HBEGF
Product Type	Antibody
Gene ID (Entrez)	15200, 1839, 25433
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence of human DTR/HBEGF (KKRDPCLRKYKDFCIHGECKYVKE).
Classification	Polyclonal
Primary or Secondary	Primary

5,923

Invitrogen™ Ki-67 Monoclonal Antibody (SolA15), Alexa Fluor™ 514

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Rat
Conjugate	Alexa Fluor 514
Applications	Immunohistochemistry (Paraffin),Multiplex Immunohistochemistry
Form	Liquid
Gene Accession No.	P46013
Isotype	IgG2a κ
Concentration	0.2 mg/mL
Antigen	Ki-67
Gene Symbols	Mki67
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	antigen identified by monoclonal antibody Ki 67; antigen identified by monoclonal antibody Ki-67; Antigen identified by monoclonal antibody Ki-67 homolog; Antigen KI-67; Antigen KI-67 homolog; antigen KI-67; proliferation marker protein Ki-67; antigen KI-67-like; cb31; D630048A14Rik; I79_022666; Ki67; Ki-67; KIA; LOW QUALITY PROTEIN: proliferation marker protein Ki-67; marker of proliferation Ki-67; MIB-; MIB-1; Mki67; PPP1R105; Proliferation marker protein Ki-67; proliferation-related Ki-67 antigen; protein phosphatase 1, regulatory subunit 105; RP11-380J17.2; sb:cb31; si:ch211-250b22.7; unnamed protein product; wu:fa11g09; wu:fb57a07; wu:fi14e05
Gene	Mki67
Product Type	Antibody
Gene ID (Entrez)	4288
Formulation	PBS with 0.5% BSA, 10% proprietary stabilizer and 0.05% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SolA15

5,924

IgM Monoclonal Antibody (SA-DA4), Brilliant Violet™ 480, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Violet 480
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P01871
Concentration	5 μL/Test
Antigen	Human IgM
Gene Symbols	IGHM
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AGM1; IGHM; immunoglobulin heavy constant mu; MU; VH
Gene	IGHM
Gene ID (Entrez)	3507
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SA-DA4

5,925

Invitrogen™ Axl Recombinant Mouse Monoclonal Antibody (DS7HAXL)

Mouse Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P30530
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	Axl
Gene Symbols	AXL
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	Adhesion-related kinase; AI323647; ARK; AXL; AXL oncogene; AXL receptor tyrosine kinase; AXL transforming sequence/gene; AZF1; JTK11; oncogene AXL; sAXL; soluble AXL; Tyro7; Tyrosine-protein kinase receptor UFO; Ufo; ufo oncogene homolog
Gene	AXL
Product Type	Antibody
Gene ID (Entrez)	558
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	DS7HAXL

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ COX4 Monoclonal Antibody (IB52C31H10), eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ EphB1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

IL-6 Monoclonal Antibody (MP5-20F3), FITC, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SOS2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TdT Monoclonal Antibody (19-3), APC, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Galectin 9 Monoclonal Antibody (9M1-3), eFluor™ 660, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

LRP8 Recombinant Rabbit Monoclonal Antibody (23GB2520), Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD154 (CD40 Ligand) Monoclonal Antibody (MR1), Alexa Fluor™ 488, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HBEGF Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

IgM Monoclonal Antibody (SA-DA4), Brilliant Violet™ 480, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ COX4 Monoclonal Antibody (IB52C31H10), eBioscience™

Invitrogen™ EphB1 Polyclonal Antibody

IL-6 Monoclonal Antibody (MP5-20F3), FITC, eBioscience™, Invitrogen™

Invitrogen™ SOS2 Polyclonal Antibody

Invitrogen™ TdT Monoclonal Antibody (19-3), APC, eBioscience™

Invitrogen™ Galectin 9 Monoclonal Antibody (9M1-3), eFluor™ 660, eBioscience™

LRP8 Recombinant Rabbit Monoclonal Antibody (23GB2520), Invitrogen™

CD154 (CD40 Ligand) Monoclonal Antibody (MR1), Alexa Fluor™ 488, eBioscience™, Invitrogen™

Invitrogen™ HBEGF Polyclonal Antibody

IgM Monoclonal Antibody (SA-DA4), Brilliant Violet™ 480, eBioscience™, Invitrogen™