Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

6,436 – 6,450 of 1,804,726 results

6,436

Invitrogen™ CD31 Monoclonal Antibody (TLD-3A12), Biotin

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Rat,Rhesus Macaque
Host Species	Mouse
Conjugate	Biotin
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q3SWT0
Isotype	IgG1
Concentration	0.1 mg/mL
Antigen	CD31
Gene Symbols	Pecam1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	C85791; CD31; CD31 antigen; CD31, PECAM-1; CD31/EndoCAM; endoCAM; GPIIA'; I79_008304; PECA1; Pecam; PECAM1; Pecam-1; platelet and endothelial cell adhesion molecule 1; platelet endothelial cell adhesion molecule; platelet endothelial cell adhesion molecule-1; platelet/endothelial cell adhesion molecule (CD31 antigen); platelet/endothelial cell adhesion molecule 1; type I transmembrane endothelial adhesion molecule
Gene	Pecam1
Product Type	Antibody
Gene ID (Entrez)	29583, 718302
Formulation	PBS with 1% BSA and 0.09% sodium azide
Immunogen	Activated, Lewis rat derived microglial cells.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TLD-3A12

6,437

Invitrogen™ alpha Tubulin Monoclonal Antibody (TU-01), Alexa Fluor™ 488

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Alexa Fluor 488
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	A6NHL2, P05213, P0DPH7, P68363, P68366, P68368, P68369, P68373, Q3UX10, Q6PEY2, Q71U36, Q9BQE3, Q9BVA1, Q9CWF2
Isotype	IgG1
Concentration	1 mg/mL
Antigen	alpha Tubulin
Gene Symbols	Tuba1a, Tuba1b, TUBA1C, TUBA3C, TUBA3E, TUBA4A, TUBAL3, TUBB2B
Regulatory Status	RUO
Purification Method	Sequential chromatography
Gene Alias	1t; 4 tubulin; a1t; ALPHA 84C; alpha tubulin; alpha tubulin 84B; alpha[[1]] tubulin; alpha[[1]]-tubulin; alpha1; alpha1 tubulin; alpha-1 tubulin; alpha1t; alpha1tub; alpha1tub84B; alpha1-tubulin; alpha-2; alpha84B; alphaT; alphat-1; alphatub; alpha-tub; alphaTub1; alphatub84; alphaTUB84B; alpha-tub84B; alphaTub84B-PA; alphatubulin; alpha-tubulin; Alpha-tubulin 1; Alpha-tubulin 2; Alpha-tubulin 3; Alpha-tubulin 3C; alpha-tubulin 3C/D; Alpha-tubulin 3D; Alpha-tubulin 3E; alpha-tubulin 4; Alpha-tubulin 6; alphaTubulin 84B; alpha-tubulin 84B; alpha-Tubulin at 84B; alpha-tubulin I; Alpha-tubulin II; alpha-tubulin III; Alpha-tubulin isotype M-alpha-1; alpha-tubulin isotype M-alpha-2; Alpha-tubulin isotype M-alpha-4; alpha-tubulin isotype M-alpha-6; alpha-tubulin TUB1; alpha-tubulin ubiquitous; alphaTubulin84B; Alpha-Tubulin84B; ALS22; anon-EST:Liang-1.59; anon-EST:Liang-2.30; AT25469p; aTub84B; a-tub84B; bA408E5.3; B-ALPHA-1; bcm948; BEST:LD32507; cb944; CG1913; CG1913-PA; chr3R:2914276..2914416; clone 1.59; clone 2.30; Detyrosinated tubulin alpha-1A chain; Detyrosinated tubulin alpha-1B chain; Detyrosinated tubulin alpha-1C chain; Detyrosinated tubulin alpha-3 chain; Detyrosinated tubulin alpha-3C chain; Detyrosinated tubulin alpha-3D chain; Detyrosinated tubulin alpha-3E chain; DM1alpha; Dmel\CG1913; Dmel_CG1913; DTA1; fb22g06; FLJ30169; H2 ALPHA; H2-ALPHA; hum-a-tub1; hum-a-tub2; I79_019110; K-ALPHA-1; l(3)84Bd; l(3)g3; lis3; LOC100726777; LOC100731885; LOC100857858; LOC101118307; LOC106557476; M[a]4; M[a]6; ms(3)nc33; nc33; RGD1565476; similar to alpha-tubulin isoform 1; similar to tubulin alpha 1; T; Talpha1; Talpha1 alpha-tubulin; TBA1_DROME; Testis-specific alpha-tubulin; TUA; TUA1; TUA2; TUA3; Tub; Tub 84B; TUB1; Tub1C; Tub84B; TUBA1; Tuba-1; tuba1 protein; TUBA1/3/4; Tuba1a; tuba1a.L; tuba1a-a; tuba1a-b; TUBA1B; TUBA1C; tuba1l; tuba1l2; TUBA2; TUBA3; TUBA3C; TUBA3D; TUBA3E; Tuba4; Tuba4a; TUBA5; Tuba6; tuba8.S; tubA84B; tubal2; Tubalpha1; tubulin; tubulin 1 alpha-chain; tubulin 1alpha; tubulin alpha; tubulin alpha 1a; tubulin alpha 1a L homeolog; tubulin alpha 1b; tubulin alpha 1c; tubulin alpha 3; tubulin alpha 3c; tubulin alpha 3e; tubulin alpha 4a; tubulin alpha 6; tubulin alpha 8 S homeolog; tubulin alpha1; tubulin alpha-1; tubulin alpha-1 chain; tubulin alpha1 promoter; Tubulin alpha-1A chain; tubulin alpha-1B chain; Tubulin alpha-1C chain; tubulin alpha-1C chain-like; tubulin alpha-2 chain; tubulin alpha-3; Tubulin alpha-3 chain; Tubulin alpha-3C chain; tubulin alpha-3C/D chain; Tubulin alpha-3D chain; Tubulin alpha-3E chain; tubulin alpha-4 chain; Tubulin alpha-4A chain; Tubulin alpha-5 chain; tubulin alpha-5 chain-like; tubulin alpha-6 chain; tubulin alpha-8 chain; tubulin alpha-ubiquitous chain; tubulin B-alpha-1; Tubulin H2-alpha; tubulin K-alpha-1; tubulin(alpha1); tubulin, alpha 1; tubulin, alpha 1 (testis specific); tubulin, alpha 1, like; tubulin, alpha 1, like 2; tubulin, alpha 1a; tubulin, alpha 1b; tubulin, alpha 1c; tubulin, alpha 2; tubulin, alpha 3c; tubulin, alpha 3e; tubulin, alpha 4; tubulin, alpha 4a; tubulin, alpha 5; tubulin, alpha 6; tubulin, alpha, brain-specific; tubulin, alpha, ubiquitous; tubulin1alpha; tubulin84B; Tubulin-alpha1; Unknown (protein for MGC:133894); unnamed protein product; wu:fb22g06; wu:fb37a10; XELAEV_18019849mg; XELAEV_18020901mg; YML085C
Gene	TUBAL3
Product Type	Antibody
Gene ID (Entrez)	10376, 112714, 22142, 22143, 22145, 22146, 238463, 347733, 7277, 7278, 73710, 7846, 79861, 84790
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4
Immunogen	Peptide that corresponds to aa 65-79 in the N-terminus of alpha-tubulin.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TU-01

6,438

CD40 Monoclonal Antibody (1C10), PE, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P27512
Concentration	0.2 mg/mL
Antigen	CD40
Gene Symbols	CD40
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI326936; B cell surface antigen CD40; B cell-associated molecule; B-cell surface antigen CD40; Bp50; CD antigen CD40; Cd40; CD40 antigen; CD40 antigen (TNF receptor superfamily member 5); CD40 antigen, TNF receptor superfamily member 5; CD40 molecule; CD40 molecule, TNF receptor superfamily member 5; CD40L receptor; CDw40; GP39; HIGM1; I79_006806; IGM; IMD3; Immunoglobulin M; ImmunoglobulinM; membrane protein CD40; MGC9013; p50; receptor for ligand CD154; sCD40; soluble CD40; T-BAM; T-cell differentiation antigen; Tnfrsf5; TRAP; tumor necrosis factor receptor superfamily member 5; tumor necrosis factor receptor superfamily, member 5
Gene	CD40
Product Type	Antibody
Gene ID (Entrez)	21939
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	1C10

6,439

Invitrogen™ MRP2 Recombinant Rabbit Monoclonal Antibody (JA32-01)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Western Blot
Form	Liquid
Gene Accession No.	Q92887
Isotype	IgG
Concentration	1 mg/mL
Antigen	MRP2
Gene Symbols	ABCC2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	ABC30; Abcc2; AI173996; ATP binding cassette subfamily C member 2; ATP-binding cassette sub-family C member 2; ATP-binding cassette, subfamily C (CFTR/MRP), member 2; ATP-binding cassette, sub-family C (CFTR/MRP), member 2; calicular multispecific organic anion transporter; canalicular multidrug resistance protein; Canalicular multispecific organic anion transporter 1; Cmoat; CMOAT1; Cmrp; DJS; Human MRP2; KIAA1010; MRP2; multidrug resistance associated protein 2; multidrug resistance protein 2; multidrug resistance-associated protein 2
Gene	ABCC2
Product Type	Antibody
Gene ID (Entrez)	1244
Formulation	TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide within Human MRP2 aa 1496-1545.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	JA32-01

6,440

Invitrogen™ NPM1 Monoclonal Antibody (FC-61991), Alexa Fluor™ 555

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Alexa Fluor 555
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	P06748, P13084, Q61937
Isotype	IgG1
Concentration	1 mg/mL
Antigen	NPM1
Gene Symbols	NPM1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	B23; B23 antibody; B23NP; MGC104254; mNPM antibody; mNPM1 antibody; NO38; NO38 antibody; Npm; npm1; npm1.L; Nucleolar phosphoprotein B23; nucleolar protein B23.1; nucleolar protein B23/No38; nucleolar protein NO38; Nucleophosmin; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin (nucleolar phosphoprotein B23, numatrin) L homeolog; nucleophosmin 1; nucleophosmin/nucleoplasmin family, member 1; nucleoplasmin; numatrin; numatrin antibody; testicular tissue protein Li 128; unnamed protein product; XELAEV_18020022mg
Gene	NPM1
Product Type	Antibody
Gene ID (Entrez)	18148, 25498, 4869
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4
Immunogen	NPM/B23 purified from rat hepatoma.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	FC-61991

6,441

Invitrogen™ CCL3 (MIP-1 alpha) Recombinant Rat Monoclonal Antibody (DNT3CC), Alexa Fluor™ Plus 647

Rat Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Alexa Fluor Plus 647
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P10855
Isotype	IgG2a κ
Concentration	1 mg/mL
Antigen	CCL3 (MIP-1 alpha)
Gene Symbols	Ccl3
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI323804; C-C motif chemokine 3; C-C motif chemokine ligand 3; CCL3; chemokine (C-C motif) ligand 3; G0/G1 switch regulatory protein 19-1; G0S19-1; Heparin-binding chemotaxis protein; H-MIP-1-alpha; L2G25B; LD78ALPHA; LD78-alpha; LD78-alpha(4-69); Macrophage inflammatory protein 1 alpha (Small inducible cytokine A3); macrophage inflammatory protein 1-alpha; macrophage inflammatory protein-1alpha; MIP1 (a); mip1 alpha; MIP-1 alpha; MIP1-(a); MIP1A; MIP-1a; MIP-1alpha; MIP-1-alpha; MIP1-alpha; MIP-1-alpha(4-69); PAT 464.1; RP23-320E6.7; Scya3; SIS-alpha; SIS-beta; small inducible cytokine A3; small inducible cytokine A3 (homologous to mouse Mip-1a); small-inducible cytokine A3; Tonsillar lymphocyte LD78 alpha protein; TY-5
Gene	Ccl3
Product Type	Antibody
Gene ID (Entrez)	20302
Formulation	Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.3-7.3
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	DNT3CC

6,442

GM-CSF Monoclonal Antibody (DAVKAT), PE, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Rat
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P04141
Concentration	5 μL/Test
Antigen	GM-CSF
Gene Symbols	CSF2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	colony stimulating factor 2; colony stimulating factor 2 (granulocyte-macrophage); colony-stimulating factor; CSF; CSF2; Csfgm; cytokine; GMCSF; Gm-CSf; granulocyte macrophage colony stimulating factor; granulocyte macrophage-colony stimulating factor; granulocyte-macrophage colony stimulating factor 2; granulocyte-macrophage colony-stimulating factor; MGC131935; MGC138897; MGC151255; MGC151257; MGI-IGM; M-GM-CSF; molgramostin; put. GM-CSF; sargramostim
Gene	CSF2
Product Type	Antibody
Gene ID (Entrez)	1437
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	DAVKAT

6,443

Invitrogen™ BMP5 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P22003, P49003
Isotype	IgG
Concentration	500 μg/mL
Antigen	BMP5
Gene Symbols	Bmp5
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AU023399; BMP; BMP 5; Bmp5; BMP-5; bone morphogenenic protein-5; Bone morphogenetic protein; bone morphogenetic protein 5; MGC34244; se; short ear
Gene	Bmp5
Product Type	Antibody
Gene ID (Entrez)	12160, 315824, 653
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL).
Classification	Polyclonal
Primary or Secondary	Primary

6,444

Invitrogen™ Phospho-p38 MAPK gamma/delta (Tyr185, Tyr182) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	O08911, O15264, P53778, Q63538, Q9WTY9, Q9Z1B7
Isotype	IgG
Concentration	1 mg/mL
Antigen	Phospho-p38 MAPK gamma/delta (Tyr185, Tyr182)
Gene Symbols	MAPK12, MAPK13
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AW123708; ERK3; ERK6; ERK-6; Exon skip; extracellular signal-regulated kinase 6; MAP kinase 12; MAP kinase 13; MAP kinase p38 delta; MAP kinase p38 gamma; MAPK 12; MAPK 13; MAPK12; MAPK13; MAPK-13; mitogen activated protein kinase 12; mitogen activated protein kinase 13; mitogen-activated protein kinase 12; Mitogen-activated protein kinase 13; mitogen-activated protein kinase 3; mitogen-activated protein kinase p38 delta; Mitogen-activated protein kinase p38 gamma; p38 delta MAP kinase; p38delta; P38GAMMA; PRKM12; Prkm13; SAP kinase-3; SAPK/Erk/kinase 4; SAPK3; SAPK-3; SAPK4; Serk4; stress activated protein kinase 3; stress-activated protein kinase 3; Stress-activated protein kinase 4
Gene	MAPK13
Product Type	Antibody
Gene ID (Entrez)	26415, 29513, 29857, 5603, 60352, 6300
Formulation	PBS with 50% glycerol and 0.02% sodium azide; pH 7.4
Immunogen	A synthesized peptide derived from human p38 MAPK gamma/delta (Phospho-Tyr185/182).
Classification	Polyclonal
Primary or Secondary	Primary

6,445

Invitrogen™ HLA-DR Monoclonal Antibody (LN3), Alexa Fluor™ Plus 594

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor Plus 594
Applications	Immunohistochemistry (Paraffin),Multiplex Immunohistochemistry
Form	Liquid
Gene Accession No.	P01903, P01911, P04233, P13762, P79483, Q30154
Isotype	IgG2b κ
Concentration	0.2 mg/mL
Antigen	HLA-DR
Gene Symbols	CD74, HLA-DRA, HLA-DRB1, HLA-DRB3, HLA-DRB4, HLA-DRB5
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI323765; BLA-DRB3; BOLA-DRA; BoLA-DR-alpha; BoLA-DRB; BOLA-DRB3; BoLA-DRB3 protein; BoLA-DRB3.2; Bota-DRB01; Bota-DRB02; Bota-DRB04; Bota-DRB07; Bota-DRB21; Bota-DRB22; bovine leukocyte antigen; Cd74; CD74 antigen; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); CD74 molecule; Cd74 molecule, major histocompatibility complex, class II invariant chain; class II-associated invariant chain peptide; CLIP; Clone P2-beta-3; DASS-397D15.1; DHLAG; dinucleotide microsatellite; DLA class II histocompatibility antigen, DR-1 beta chain; DLA DRBB1 beta chain; DLA-DR beta; DLA-DRB1; DLA-DRBB1; DR beta-5; DR beta-chain antigen binding domain; DR-16; DR2-beta-2; DR4; DR-4; DR7; DR9; DR-9; DRB; DRB1; DRB1 transplantation antigen; DRB3; DRB4; DRBB1; DR-beta chain; DR-beta chain MHC class II; DRw10; Dw2; DW2.2/DR2.2; E-alpha-f; FLJ51114; FLJ75017; FLJ76359; gamma chain of class II antigens; H-2 class II histocompatibility antigen gamma chain; H-2 class II histocompatibility antigen, E-D alpha chain; H-2 class II histocompatibility antigen, E-K alpha chain; H-2 class II histocompatibility antigen, E-U alpha chain; H-2Ea; H2-Ea; H2-Ea-ps; H2-IE-alpha; histocompatibility 2, class II antigen E alpha; histocompatibility 2, class II antigen E alpha, pseudogene; histocompatibility antigen HLA-DR alpha; histocompatibility complex, class II, DR beta 3; histocompatibility: class II antigens, gamma chain of; HLA class II histocompatibility antigen gamma chain; HLA class II histocompatibility antigen, DR alpha chain; HLA class II histocompatibility antigen, DR beta 3 chain; HLA class II histocompatibility antigen, DR beta 4 chain; HLA class II histocompatibility antigen, DR beta 5 chain; HLA class II histocompatibility antigen, DR-1 beta chain; HLA class II histocompatibility antigen, DR-5 beta chain; HLA class II histocompatibility antigen, DRB1-15 beta chain; HLA class II histocompatibility antigen, DRB1-16 beta chain; HLA class II histocompatibility antigen, DRB1-3 chain; HLA class II histocompatibility antigen, DRB1-7 beta chain; HLA class II histocompatibility antigen, DRB1-9 beta chain; HLADG; HLA-DR antigens-associated invariant chain; HLA-DR1B; HLA-DR3B; HLA-DR4B; HLA-DRA; HLA-DRA1; HLA-DRB; HLA-DRB1; HLA-DRB2; HLA-DRB3; HLA-DRB4; HLA-DRB5; HLA-DR-gamma; human leucocyte antigen DRB1; human leucocyte antigen DRB3; human leucocyte antigen DRB4; human leucocyte antigen DRB5; ia antigen-associated invariant chain; Ia3; Ia-3; Ia-associated invariant chain; Ia-GAMMA; I-E alpha MHC class II; I-Ealpha; II; integral membrane glycoprotein; invariant gamma chain; invariant polypeptide of major histocompatibility complex, class II antigen-associated; INVG34; LA-DRB; leukocyte antigen; leukocyte antigen class II; leukocyte antigen DRB3; lymphocyte antigen DRB1; major histocompatibility complex class II DR-beta chain; major histocompatibility complex, class II, DR alpha; major histocompatibility complex, class II, DR alpha precursor; major histocompatibility complex, class II, DR beta 1; major histocompatibility complex, class II, DR beta 3; major histocompatibility complex, class II, DR beta 4; major histocompatibility complex, class II, DR beta 4 precursor; major histocompatibility complex, class II, DR beta 5; major histocompatibility complex, class II, DRB3; MHC cell surface glycoprotein; MHC class I antigen; MHC class II antigen; MHC class II antigen beta chain; MHC class II antigen BoLA-DRB3; MHC class II antigen DR beta 3 chain; MHC class II antigen DRA; MHC class II antigen DRB115; MHC class II antigen DRB116; MHC class II antigen DRB13; MHC class II antigen DRB19; MHC class II antigen DRB3; MHC class II antigen DRB4; MHC class II antigen DRB5; MHC class II antigen E alpha; MHC class II antigen HLA-DR-beta; MHC class II DLA DRB1 beta chain; MHC class II DLA-DRB; MHC class II DLA-DR-beta-1; MHC class II DR beta 1; MHC class II DR beta chain; MHC class II DR beta-chain
Gene	HLA-DRB4
Product Type	Antibody
Gene ID (Entrez)	3122, 3123, 3125, 3126, 3127, 972
Formulation	PBS with 0.5% BSA, 10% proprietary stabilizer and 0.05% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	LN3

6,446

Invitrogen™ CD4 Monoclonal Antibody (RM4-5), Pacific Orange™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Rat
Conjugate	Pacific Orange
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P06332
Isotype	IgG2a
Concentration	0.1 mg/mL
Antigen	CD4
Gene Symbols	CD4
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	Activation B7-1 antigen; B7; B7.1; B7-1; BB1; B-lymphocyte activation antigen B7; CD28LG; CD28LG1; CD4; CD4 antigen; CD4 antigen (p55); CD4 antigen p55; Cd4 molecule; CD4 precursor; CD4 receptor; CD4, allele 1; cd4a; CD4mut; CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); CD80 molecule; cell surface glycoprotein CD4; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; fCD4; L3T4; LAB7; Leu-3; Ly-4; lymphocyte antigen CD4; lymphocyte antigen CD4 precursor; membrane protein; p55; T-cell differentiation antigen L3T4; T-cell surface antigen T4/Leu-3; T-cell surface glycoprotein CD4; T-cell surface glycoprotein CD4 precursor (T-cell surface antigen T4/Leu-3) (T-cell differentiation antigen L3T4); T-lymphocyte activation antigen CD80; W3/25; W3/25 antigen
Gene	CD4
Product Type	Antibody
Gene ID (Entrez)	12504
Formulation	PBS with 4mg/mL BSA and 0.1% sodium azide
Immunogen	Mouse CD4.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RM4-5

6,447

Invitrogen™ TREX1 Monoclonal Antibody (1B1)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Liquid
Gene Accession No.	Q9NSU2
Isotype	IgG2a κ
Concentration	0.34 mg/mL
Antigen	TREX1
Gene Symbols	TREX1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	1661; 3' repair exonuclease 1; 3'-5' exonuclease TREX1; AGS1; AU041952; CRV; Deoxyribonuclease III; DNase III; DRN3; HERNS; RGD1309596; three prime exonuclease 1; three prime repair exonuclease 1; three-prime repair exonuclease 1; Trex1; trophoblast expressed 1
Gene	TREX1
Product Type	Antibody
Gene ID (Entrez)	11277
Formulation	PBS with no preservative; pH 7.4
Immunogen	TREX1 (NP_057465, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	1B1

6,448

Invitrogen™ PSD93 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Immunoprecipitation,Western Blot
Form	Liquid
Gene Accession No.	Q15700, Q63622, Q91XM9
Isotype	IgG
Concentration	0.25 mg/mL
Antigen	PSD93
Gene Symbols	DLG2
Regulatory Status	RUO
Purification Method	Antigen Affinity Chromatography
Gene Alias	A330103J02Rik; B230218P12Rik; B330007M19Rik; channel-associated protein of synapse-110; channel-associated protein of synapses, 110kDa; Chapsyn-1; chapsyn-110; discs large 2; discs large homolog 2; discs large MAGUK scaffold protein 2; discs, large homolog 2; discs, large homolog 2 (Drosophila); discs, large homolog 2, chapsyn-110; disks large homolog 2; DLG2; Dlgh2; Gm1197; Postsynaptic density protein PSD-93; PPP1R58; protein phosphatase 1, regulatory subunit 58; PSD93; PSD-93; synaptic density protein PSD-93
Gene	DLG2
Product Type	Antibody
Gene ID (Entrez)	1740, 23859, 64053
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	A synthetic peptide derived from the mid region of PSD-93 protein.
Classification	Polyclonal
Primary or Secondary	Primary

6,449

CD138 (Syndecan-1) Monoclonal Antibody (DL-101), Super Bright™ 600, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Super Bright 600
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P18827
Concentration	5 μL/Test
Antigen	CD138 (Syndecan-1)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Product Type	Antibody
Gene ID (Entrez)	6382
Classification	Monoclonal
Primary or Secondary	Primary
Clone	DL-101

6,450

Invitrogen™ SQSTM1 Monoclonal Antibody (GT239)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O08623, Q13501, Q64337
Isotype	IgG2a
Concentration	1 mg/mL
Antigen	SQSTM1
Gene Symbols	Sqstm1
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	A170; EBI3-associated protein of 60 kDa; EBI3-associated protein p60; EBIAP; FTDALS3; hypothetical protein 1; ORCA; OSF-6; Osi; OSIL; oxidative stress induced; oxidative stress induced like; p60; p62; p62B; PDB3; phosphotyrosine independent ligand for the Lck SH2 domain p62; phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa; PKC-zeta-interacting protein; protein kinase C-zeta-interacting protein; sb:cb621; Sequestosome 1; sequestosome-1; Sqstm1; STAP; STONE14; ubiquitin-binding protein p62; Unknown (protein for MGC:127197); zgc:85784; ZIP; ZIP3
Gene	Sqstm1
Product Type	Antibody
Gene ID (Entrez)	113894, 18412, 8878
Formulation	PBS with no preservative
Immunogen	Recombinant protein encompassing a sequence within the center region of human SQSTM1/P62. The exact sequence is proprietary.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	GT239

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ CD31 Monoclonal Antibody (TLD-3A12), Biotin Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ alpha Tubulin Monoclonal Antibody (TU-01), Alexa Fluor™ 488 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD40 Monoclonal Antibody (1C10), PE, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MRP2 Recombinant Rabbit Monoclonal Antibody (JA32-01) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NPM1 Monoclonal Antibody (FC-61991), Alexa Fluor™ 555 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

GM-CSF Monoclonal Antibody (DAVKAT), PE, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ BMP5 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-p38 MAPK gamma/delta (Tyr185, Tyr182) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD4 Monoclonal Antibody (RM4-5), Pacific Orange™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TREX1 Monoclonal Antibody (1B1) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PSD93 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD138 (Syndecan-1) Monoclonal Antibody (DL-101), Super Bright™ 600, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SQSTM1 Monoclonal Antibody (GT239) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD31 Monoclonal Antibody (TLD-3A12), Biotin

Invitrogen™ alpha Tubulin Monoclonal Antibody (TU-01), Alexa Fluor™ 488

CD40 Monoclonal Antibody (1C10), PE, eBioscience™, Invitrogen™

Invitrogen™ MRP2 Recombinant Rabbit Monoclonal Antibody (JA32-01)

Invitrogen™ NPM1 Monoclonal Antibody (FC-61991), Alexa Fluor™ 555

GM-CSF Monoclonal Antibody (DAVKAT), PE, eBioscience™, Invitrogen™

Invitrogen™ BMP5 Polyclonal Antibody

Invitrogen™ Phospho-p38 MAPK gamma/delta (Tyr185, Tyr182) Polyclonal Antibody

Invitrogen™ CD4 Monoclonal Antibody (RM4-5), Pacific Orange™

Invitrogen™ TREX1 Monoclonal Antibody (1B1)

Invitrogen™ PSD93 Polyclonal Antibody

CD138 (Syndecan-1) Monoclonal Antibody (DL-101), Super Bright™ 600, eBioscience™, Invitrogen™

Invitrogen™ SQSTM1 Monoclonal Antibody (GT239)