
Primary Antibodies
Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

All Primary Antibodies
(1,312,556)

Primary Antibody Matched Pairs
(4,212)

Protein Interaction Antibody Pairs
(700)

Protein Phosphorylation Antibody Pairs
(55)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

1
–
15
of
1,245,208
results
Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human,Mouse,Rat,Monkey |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P08588, P18090, P34971 |
Isotype | IgG |
Concentration | Conc. Not Determined |
Antigen | beta-1 Adrenergic Receptor |
Gene Symbols | ADRB1 |
Regulatory Status | RUO |
Gene Alias | Adrb1; Adrb-1; ADRB1R; adrenergic receptor, beta 1; adrenergic, beta-1-, receptor; adrenoceptor beta 1; B1AR; beta 1-adrenergic receptor beta 1-AR; beta 1-AR; beta-1 adrenergic receptor; Beta-1 adrenoceptor; beta-1 adrenoreceptor; BETA1AR; beta-AR; cardiac beta adrenergic receptor; RATB1AR; RHR |
Gene | ADRB1 |
Product Type | Antibody |
Gene ID (Entrez) | 11554, 153, 24925 |
Formulation | Whole serum with 0.05% sodium azide |
Immunogen | Synthetic peptide corresponding to residues H(394) G D R P R A S G C L A R A G(408) of mouse B1AR. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human,Mouse,Rat,Canine,Rabbit,Monkey |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Flow Cytometry,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P14211, P15253, P18418, P27797, P28490 |
Isotype | IgG |
Concentration | Conc. Not Determined |
Antigen | Calreticulin |
Gene Symbols | CALR |
Regulatory Status | RUO |
Gene Alias | Autoantigen RO; CABP3; CALBP; calcium-binding protein 3; CALR; calrectulin; calregulin; Calreticulin; calreticulin precursor; cC1qR; CRP55; CRT; CRTC; Endoplasmic reticulum resident protein 60; epididymis secretory sperm binding protein Li 99n; ERp60; FLJ26680; grp60; HACBP; HEL-S-99n; I79_008346; RO; Ro/SS-A Antigen; Sicca syndrome antigen A (autoantigen Ro; calreticulin); SSA |
Gene | CALR |
Product Type | Antibody |
Gene ID (Entrez) | 100009050, 100350417, 12317, 476694, 64202, 811 |
Formulation | Whole serum with 0.05% sodium azide |
Immunogen | Recombinant, human calreticulin protein. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Human Midkine Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody has been used in 5 publications
Human/Mouse Syntaxin 12 Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Antibody
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
---|---|
Target Species | Human,Mouse |
Host Species | Goat |
Conjugate | Unconjugated |
Applications | Immunohistochemistry |
Form | Lyophilized |
Isotype | IgG |
Gene Accession No. | Q86Y82 |
Antigen | Syntaxin 12 |
Purification Method | Antigen Affinity-purified |
Dilution | Immunohistochemistry 1-15 μg/mL |
Gene Alias | MGC51957, STX12, STX13, STX14, syntaxin 12, syntaxin-12 |
Gene ID (Entrez) | 23673.0 |
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. |
Immunogen | E.coli-derived recombinant human Syntaxin 12, Met1-Gln200, Accession No. Q86Y82 |
Classification | Polyclonal |
Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects human Syntaxin 12 in direct ELISAs. Detects human and mouse Syntaxin 12 in immunohistochemistry. |
ULBP-4/RAET1E Antibody (709116) [Alexa Fluor™ 532], Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Alpha-Smooth Muscle Actin Monoclonal Antibody (1A4), eFluor™ 660, eBioscience™, Invitrogen™
Mouse Monoclonal Antibody


Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Mouse |
Conjugate | eFluor 660 |
Applications | Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
Form | Liquid |
Isotype | IgG2a κ |
Gene Accession No. | P62736, P62737, P62738 |
Concentration | 0.2 mg/mL |
Antigen | Alpha-Smooth Muscle Actin |
Gene Symbols | ACTA2 |
Regulatory Status | RUO |
Purification Method | Affinity chromatography |
Gene Alias | 0610041G09Rik; AAT6; ACT-4; acta2; acta2.L; acta2.S; actin; Actin Alpha 2 Smooth Muscle Aorta; actin alpha 2, smooth muscle; Actin Vascular Smooth Muscle; actin, alpha 2, smooth muscle, aorta; actin, alpha 2, smooth muscle, aorta L homeolog; actin, alpha 2, smooth muscle, aorta S homeolog; actin, alpha, vascular smooth muscle; actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; ACTSA; ACTVS; alpha actin 2; Alpha Cardiac Actin; alpha smooth muscle actin; alpha-actin; Alpha-actin-2; alpha-cardiac actin; alphaSMA; alpha-SM-actin; alpha-smooth muscle actin; Aortic Smooth Muscle; asma; a-sma; cell growth-inhibiting gene 46 protein; GIG46; Growth Inhibiting Gene 46; hypothetical protein LOC515610; LOW QUALITY PROTEIN: actin, aortic smooth muscle; mymy5; SM actin; sma; SMactin; sm-actin; SMalphaA; smooth muscle; smooth muscle alpha-actin; vascular smooth muscle alpha-actin; wu:fb63d03; XELAEV_18034370mg |
Gene | ACTA2 |
Product Type | Antibody |
Gene ID (Entrez) | 11475, 59, 81633 |
Formulation | PBS with 0.09% sodium azide; pH 7.2 |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 1A4 |
OVA257-264 (SIINFEKL) peptide bound to H-2Kb Monoclonal Antibody (eBio25-D1.16 (25-D1.16)), Biotin, eBioscience™, Invitrogen™
Mouse Monoclonal Antibody


Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
---|---|
Target Species | Mouse |
Host Species | Mouse |
Conjugate | Biotin |
Applications | Flow Cytometry,Immunohistochemistry |
Form | Liquid |
Isotype | IgG1 κ |
Concentration | 0.5 mg/mL |
Antigen | OVA257-264 (SIINFEKL) peptide bound to H-2Kb |
Regulatory Status | RUO |
Purification Method | Affinity Chromatography |
Gene Alias | H-2Kb-SIINFEKL; OVA257-264; OVA257-264 H-2Kb; OVA-Kb |
Product Type | Antibody |
Formulation | PBS with 0.09% sodium azide; pH 7.2 |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | eBio25-D1.16 (25-D1.16) |
Content And Storage | -20°C |
---|---|
Target Species | Human |
Host Species | Rat |
Conjugate | Unconjugated |
Applications | ELISA,Western Blot |
Form | Liquid |
Gene Accession No. | P05112 |
Isotype | IgG1 |
Concentration | 1.0 mg/mL |
Antigen | IL-4 |
Gene Symbols | Il4 |
Regulatory Status | RUO |
Purification Method | Protein G |
Gene Alias | B cell growth factor 1; B_cell stimulatory factor 1; B-cell growth factor 1; B-cell IgG differentiation factor; B-cell stimulatory factor 1; BCGF1; BCGF-1; binetrakin; BSF1; BSF-1; cytokine; H-IL-4; IGG1 induction factor; IL2; IL4; Il-4; Il4e12; ILN; Interleukin; interleukin 4; interleukin 4 variant 2; interleukin 4 variant IL-4delta2; interleukin 4 variant IL-4delta3; interleukin 4 variant IL-4int2A; interleukin 4 variant IL-4int3A; interleukin 4 variant IL-4int3B; Interleukin4; interleukin-4; interleukin-4 precursor; lymphocyte stimulatory factor 1; MGC79402; M-IL-4; Pitrakinra |
Gene | Il4 |
Product Type | Antibody |
Gene ID (Entrez) | 3565 |
Formulation | PBS with no preservative |
Immunogen | Recombinant human IL-4 (CHO cell-derived). |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 25D2 |
Recoverin Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence |
Form | Purified |
Isotype | IgG |
Research Discipline | Neuroscience, Vision |
Antigen | Recoverin |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Gene Alias | cancer associated retinopathy antigen, Protein CAR, RCV1Cancer-associated retinopathy protein, recoverin |
Gene ID (Entrez) | 5957 |
Formulation | PBS (pH 7.3), 50% glycerol |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Recoverin (NP_002894.1).,, Sequence:, MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Tag |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry |
Form | Liquid |
Isotype | IgG1 |
Concentration | 1 mg/mL |
Antigen | V5 Tag |
Regulatory Status | RUO |
Purification Method | Protein A |
Gene Alias | simian virus 5 antibody; SPV5gp2; sv5; V5; v-5; V5 Epitope Tag |
Product Type | Antibody |
Formulation | PBS with no preservative; pH 7.2 |
Immunogen | GKPIPNPLLGLDST (V5) synthetic peptide conjugated to KLH. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | E10/V4RR |
Human GLP-1 Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Monoclonal Antibody
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70°C as supplied. 1 month, 2 to 8°C under sterile conditions after reconstitution. 6 months, -20 to -70°C under sterile conditions after reconstitution. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA |
Form | Purified |
Isotype | IgG |
Gene Accession No. | P01275 |
Antigen | GLP1 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified from cell culture supernatant |
Gene Alias | glicentin-related polypeptide, GLP1, glucagon-like peptide 1, GRPP |
Gene ID (Entrez) | 2641 |
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. |
Immunogen | Human GLP-1 synthetic peptide, Accession # P01275 |
Classification | Monoclonal |
Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Clone | 2622G |
Content And Storage | 4°C, store in dark |
---|---|
Target Species | Human,Mouse,Rat,Monkey,Bovine |
Host Species | Rabbit |
Conjugate | DyLight 650 |
Applications | Flow Cytometry,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | O97552, P20263, Q01860 |
Isotype | IgG |
Concentration | 0.80 mg/mL |
Antigen | OCT4 |
Gene Symbols | POU5F1 |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | 2-Oct; 3-Oct; 4-Oct; cb197; chunp6868; DADB-104B20.2; etID49452.21; gp9; gp-9; HGNC:9221; homeobox protein; lymphoid-restricted immunoglobulin octamer-binding protein NF-A2; MGC22487; NF-A3; Oct2; Oct-2; Oct2a; Oct2b; OCT3; Oct-3; Oct3/4; Oct-3/4; OCT4; Oct-4; Octamer-binding protein 2; octamer-binding protein 3; Octamer-binding protein 4; octamer-binding transcription factor 2; Octamer-binding transcription factor 3; OTF2; OTF-2; OTF3; Otf-3; Otf3g; Otf3-rs7; Otf4; Otf-4; OTTHUMP00000221150; OTTHUMP00000221151; POU class 2 homeobox 2; POU class 5 homeobox 1; POU class 5 homeobox 1 transcript variant OCT4B1; POU class 5 homeobox 1 transcript variant OCT4B2; POU class 5 homeobox 1 transcript variant OCT4B3; POU class 5 homeobox 1 transcript variant OCT4B4; POU class 5 homeobox 1 transcript variant OCT4B5; POU class 5 homeobox 1 transcript variant OCT4B6; POU domain class 5 transcription factor 1; POU domain gene 2; POU domain protein 2; POU domain transcription factor OCT4; POU domain, class 2, transcription factor 2; POU domain, class 5, transcription factor 1; POU domain, class 5, transcription factor 3; pou2; pou-2; POU2F2; Pou5f1; pou5f1 protein; pou5f3; POU-type homeodomain-containing DNA-binding protein; spg; spg/pou2; spiel-ohne-grenzen; spiel-ohne-grenzen/pou2; wu:fd18d06 |
Gene | POU5F1 |
Product Type | Antibody |
Gene ID (Entrez) | 18999, 282316, 294562, 5460 |
Formulation | 50mM sodium borate with 0.05% sodium azide |
Immunogen | A synthetic peptide made to an internal portion of the human OCT4 protein (between residues 100-200). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Invitrogen™ GFP Polyclonal Antibody
Rabbit Polyclonal Antibody


Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | 4°C |
---|---|
Target Species | Tag |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Western Blot,Immunocytochemistry |
Form | Liquid |
Isotype | IgG |
Concentration | 2 mg/mL |
Antigen | GFP |
Regulatory Status | RUO |
Purification Method | IgG fraction |
Gene Alias | GFP; GFP tag; GFP2; green fluorescence; green fluorescent; Turbo eGFP |
Product Type | Antibody |
Formulation | PBS with 5mM sodium azide; pH 7.2 |
Immunogen | The GFP was isolated directly from the jellyfish Aequorea victoria. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Invitrogen™ NEFH Monoclonal Antibody (RMdO-20)
Mouse Monoclonal Antibody


Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -20°C |
---|---|
Target Species | Human,Mouse,Rat,Rabbit,Bovine,Hamster,Mollusca |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | ELISA,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P12036, P16884, P19246 |
Isotype | IgG1 κ |
Concentration | 0.5 mg/mL |
Antigen | NEFH |
Gene Symbols | Nefh |
Regulatory Status | RUO |
Purification Method | Purified |
Gene Alias | 200 kDa neurofilament protein; CMT2CC; heavy neurofilament protein; I79_012512; intermediate filament protein; KIAA0845; LOW QUALITY PROTEIN: neurofilament heavy polypeptide; mKIAA0845; NEF3; Nefh; nefh.L; neurofilament; neurofilament 200kDa; neurofilament heavy; neurofilament heavy L homeolog; neurofilament heavy polypeptide; neurofilament heavy polypeptide-like; neurofilament triplet H protein; neurofilament, heavy polypeptide; neurofilament, heavy polypeptide 200kDa; neurofilament, heavy polypeptide L homeolog; neurofilament-H; NF 200 kD; NF200; Nfh; NF-H; NHC; XELAEV_18007418mg |
Gene | Nefh |
Product Type | Antibody |
Gene ID (Entrez) | 100357177, 100753127, 101838568, 24587, 380684, 4744, 528842 |
Formulation | PBS with 0.1% sodium azide |
Immunogen | Adult Rat neurofilaments. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | RMdO-20 |