All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,451)
- (21,592)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (52)
- (1)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (11)
- (12,287)
- (15,876)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (535)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (3)
- (16)
- (110)
- (1)
- (189,995)
- (288,104)
- (1)
- (19)
- (798)
- (1)
- (12,214)
- (2)
- (129)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,751)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (359)
- (5)
- (13,001)
- (2)
- (4,300)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,038)
- (3,903)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,767)
- (18)
- (1)
- (1)
- (1)
- (5,545)
- (3)
- (2)
- (43)
- (4)
- (13)
- (1)
- (164)
- (748)
- (17)
- (2)
- (6)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,865)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (187)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (7)
- (23)
- (130)
- (8,934)
- (39,658)
- (448)
- (53)
- (1,929)
- (1)
- (36)
- (7)
- (1)
- (2,681)
- (1)
- (4,478)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,161)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,469)
- (16)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,527)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,961)
- (24,935)
- (24,831)
- (24,992)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,906)
- (11)
- (3)
- (221)
- (761)
- (1,054)
- (721)
- (777)
- (920)
- (889)
- (1,009)
- (850)
- (1,470)
- (910)
- (835)
- (1,058)
- (1,059)
- (1,056)
- (681)
- (1,087)
- (30,490)
- (90)
- (9)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,922)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (33,652)
- (5)
- (30)
- (1)
- (1)
- (338)
- (734)
- (30,825)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (99)
- (11)
- (22)
- (58)
- (26)
- (127)
- (158)
- (25)
- (84)
- (58)
- (24)
- (56)
- (75)
- (9)
- (65)
- (73)
- (95)
- (84)
- (78)
- (28)
- (64)
- (70)
- (44)
- (58)
- (50)
- (53)
- (98)
- (122)
- (41)
- (58)
- (65)
- (77)
- (75)
- (454)
- (32,847)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (858)
- (142)
- (536)
- (429)
- (878)
- (402)
- (325)
- (815)
- (756)
- (721)
- (2)
- (630)
- (722)
- (290)
- (752)
- (822)
- (634)
- (807)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (11)
- (6)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (542,594)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (564)
- (2,894)
- (51)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,671)
- (68)
- (123)
- (2,111)
- (31,228)
- (221)
- (8)
- (23)
- (597,679)
- (16)
- (1)
- (800,229)
- (84,197)
- (3)
- (45,150)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (468)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (1)
- (5)
- (8,432)
- (7,041)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,238)
- (43)
- (425)
- (171)
- (2,278)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (677)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (70)
- (275)
- (18)
- (1,253)
- (6,085)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,697)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,499)
- (2,675)
- (43,522)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,414)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,837)
- (4)
- (290,181)
- (153,811)
- (191)
- (53)
- (197,229)
- (502,585)
- (77)
- (1,445)
- (43,005)
- (14)
- (267)
- (12,831)
- (529,528)
- (202)
- (609)
- (2)
- (3)
- (551)
- (6)
- (4)
- (211,657)
- (2,647)
- (27)
- (10)
- (51)
- (526)
- (25)
- (270)
- (1,156)
- (1,424)
- (7)
- (8)
- (1,339)
- (4)
- (2)
- (3)
- (26)
- (6,535)
- (1)
- (6)
- (814)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,208)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (261)
- (437)
- (1,280)
- (39)
- (6)
- (43,436)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,390)
- (9)
- (2)
- (4)
- (135)
- (2)
- (1)
- (2,798)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,778)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,642)
- (258)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,080,888)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (8)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,269)
- (51)
- (2)
- (5,100)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,897)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,697)
- (821)
- (2)
- (2)
- (4)
- (8)
- (5)
- (1,307)
- (9,923)
- (376)
- (1,447)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (9)
- (1)
- (18)
- (3)
- (2)
- (1,266)
- (3,505)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,889)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,779)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,494)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,223)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (709)
- (1,433,680)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (23,997)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,363)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,444)
- (5)
- (4)
- (46)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,491)
- (545)
- (215)
- (25)
- (1,234)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,252)
- (532)
- (4)
- (10)
- (2)
- (338,674)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,777)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,894)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (23)
- (82)
- (2,574)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,929)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
Invitrogen™ SLIT2 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Western Blot |
| Form | Liquid |
| Gene Accession No. | O94813, Q9R1B9, Q9WVC1 |
| Isotype | IgG |
| Concentration | 0.41 mg/mL |
| Antigen | SLIT2 |
| Gene Symbols | SLIT2 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | downregulated during adipocyte differentiation-1; Drad-1; E030015M03Rik; E130320P19Rik; mKIAA4141; neurogenic extracellular slit protein; SLIL3; Slit; slit guidance ligand 2; slit homolog 2 (Drosophila); slit homolog 2 protein; Slit homolog 2 protein C-product; Slit homolog 2 protein N-product; SLIT2; Slit-2; Slit2 protein |
| Gene | SLIT2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 20563, 360272, 9353 |
| Formulation | PBS with 20% glycerol, 1% BSA and 0.025% ProClin 300; pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the center region of human SLIT2. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ CD196 (CCR6) Monoclonal Antibody (R6H1), Brilliant Violet™ 421, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Brilliant Violet 421 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P51684 |
| Isotype | IgG1 κ |
| Concentration | 5 μL/Test |
| Antigen | CD196 (CCR6) |
| Gene Symbols | CCR6 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | BN-1; CC chemokine receptor 6; C-C chemokine receptor type 6; C-C CKR-6; C-C motif chemokine receptor 6; CC-CKR-6; CCR6; CCR-6; CD196; chemokine (C-C motif) receptor 6; chemokine (C-C) receptor 6; chemokine receptor-like 3; CKR6; CKRL3; CKR-L3; Cmkbr6; DCR2; DRY6; DRY-6; G protein-coupled receptor 29; GPR29; GPRCY4; GPR-CY4; G-protein coupled receptor 29; KY411; LARC receptor; seven-transmembrane receptor, lymphocyte, 22; STRL22 |
| Gene | CCR6 |
| Product Type | Antibody |
| Gene ID (Entrez) | 1235 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | R6H1 |
Invitrogen™ OPN-R Recombinant Superclonal™ Antibody (24 HCLC)
Rabbit Recombinant Superclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P08721, P10451, P10923 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | OPN-R |
| Gene Symbols | SPP1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 2AR; 2b7; 44 kDa bone phosphoprotein; Apl-1; BNSP; Bone sialoprotein 1; Bsp; BSPI; Calcium oxalate crystal growth inhibitor protein; early T-lymphocyte activation 1; early T-lymphocyte activation 1 protein; Eta; ETA-1; Minopontin; nephropontin; Op; Opn; Opnl; OSP; Osteopontin; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; osteopontin-like protein; PSEC0156; Ric; Secreted phosphoprotein 1; secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1); secreted phosphoprotein 1 variant 6; Sialoprotein (osteopontin); SPP1; Spp-1; SPP1/CALPHA1 fusion; Thrombin OPN-R; urinary stone protein; Uropontin |
| Gene | SPP1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 20750, 25353, 6696 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Peptide corresponding to Human SPP1 (aa 158-165). |
| Classification | Recombinant Superclonal |
| Primary or Secondary | Primary |
| Clone | 24 HCLC |
Invitrogen™ AVPR1A Recombinant Rabbit Monoclonal Antibody (7H23L17)
Rabbit Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P30560, P37288 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | AVPR1A |
| Gene Symbols | AVPR1A |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | antidiuretic hormone receptor 1A; arginine vasopressin receptor 1A; arginine vasopressin receptor V1a; AVPR; AVPR V1a; AVPR1; Avpr1a; SCCL vasopressin subtype 1a receptor; V1a; V1a arginine vasopressin receptor; V1a receptor; V1a vasopressin receptor; V1aR; V1-vascular vasopressin receptor AVPR1A; Vascular/hepatic-type arginine vasopressin receptor; vasopressin V1a receptor; Vasopressin V1aR |
| Gene | AVPR1A |
| Product Type | Antibody |
| Gene ID (Entrez) | 25107, 552 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Peptide corresponding to human AVPR1A [aa398-aa418]. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 7H23L17 |
Invitrogen™ MHC Class II (I-A) Monoclonal Antibody (NIMR-4), PE, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | PE |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P01921, P06342, P06343, P06344, P06345, P06346, P14483 |
| Isotype | IgG2b |
| Concentration | 0.1 mg/mL |
| Antigen | MHC Class II (I-A) |
| Gene Symbols | H2-Ab1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | Abeta; AI845868; H-2 class II histocompatibility antigen, A beta chain; H-2Ab; H2-Ab; H2-Ab1; H2-iabeta; histocompatibility 2, class II antigen A, beta 1; Ia2; Ia-2; IAb; I-Abeta; major histocompatibility complex class II beta chain; MHC class II antigen A beta; MHC class II H2-IA-beta-psi; response to metastatic cancers 1; Rmcs1 |
| Gene | H2-Ab1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 14961 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | NIMR-4 |
Invitrogen™ S100B Recombinant Rabbit Monoclonal Antibody (RM304)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P04271 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | S100B |
| Gene Symbols | S100B |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AI850290; Bpb; hypothetical protein LOC525716; NEF; protein S100-B; S100; S100 calcium binding protein B; S100 calcium binding protein beta (neural); S100 calcium-binding protein B; S100 calcium-binding protein beta (neural); S-100 calcium-binding protein beta subunit; S100 calcium-binding protein, beta (neural); S-100 calcium-binding protein, beta chain; S100 protein beta chain; S-100 protein beta chain; S-100 protein subunit beta; S100 protein, beta polypeptide; S100 protein, beta polypeptide, neural; S100B; S100-B; S100beta; S100P |
| Gene | S100B |
| Product Type | Antibody |
| Gene ID (Entrez) | 6285 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | A peptide corresponding to the C-terminus of human S100-B. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | RM304 |
Invitrogen™ IL-1 alpha Monoclonal Antibody (ILA8-H12), Biotin
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Biotin |
| Applications | ELISA |
| Form | Liquid |
| Gene Accession No. | P01583 |
| Isotype | IgG1 κ |
| Concentration | 0.5 mg/mL |
| Antigen | IL-1 alpha |
| Gene Symbols | Il1a |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | CTLA8; hematopoietin-1; IL 1 a; IL 1α; IL1; IL-1 alpha; IL17; IL1A; Il-1a; IL-1alpha; IL1-ALPHA; IL1F1; IL1α; ILN; Interleukin; interleukin 1 alpha; interleukin 1, alpha; interleukin 17; interleukin 1a; interleukin 1-alpha; interleukin 1-alpha (AA 1 - 152); Interleukin1 alpha; interleukin-1 alpha; interleukin-1 alpha precursor; Interleukin-17A; preinterleukin 1 alpha; pre-interleukin-1 alpha; pro-interleukin-1-alpha; RP23-160G19.8 |
| Gene | Il1a |
| Product Type | Antibody |
| Gene ID (Entrez) | 3552 |
| Formulation | PBS with 4% BSA and proprietary preservative |
| Immunogen | Recombinant human IL-1 alpha. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | ILA8-H12 |
Invitrogen™ IL13RA1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human |
| Host Species | Goat |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Neutralization,Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P78552 |
| Isotype | IgG |
| Concentration | 0.2 mg/mL |
| Antigen | IL13RA1 |
| Gene Symbols | IL13RA1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | AI882074; Cancer/testis antigen 19; CD antigen CD213a1; CD213a1; CD213a1 antigen; CT19; IL13 receptor alpha-1 chain; IL-13 receptor subunit alpha-1; IL13R; IL-13R subunit alpha-1; IL-13r[a]; IL13RA; IL-13Ra; IL13RA1; IL-13RA1; IL-13R-alpha-1; interleukin 13 receptor subunit alpha 1; interleukin 13 receptor, alpha 1; interleukin 13 receptor, alpha 1-like; interleukin-13 receptor subunit alpha-1; Interleukin-13-binding protein; LOC100360218; Novel cytokine receptor 4; NR4 |
| Gene | IL13RA1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 3597 |
| Formulation | PBS with 5% trehalose and No Preservative |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant human IL-13R alpha 1 Ala27-Thr343 (Thr130Ile). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Connexin 31 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Maintain refrigerated at 2°C to 8°C for up to 1 month. For long term storage store at -20°C |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (PFA fixed),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O75712, P28231 |
| Isotype | IgG |
| Concentration | 0.25 mg/mL |
| Antigen | Connexin 31 |
| Gene Symbols | GJB3 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | Cnx31; connexin 31; connexin-31; Cx31; Cxn-31; D4Wsu144e; DFNA2; DFNA2B; EKV; Gap junction beta-3 protein; gap junction membrane channel protein beta 3; gap junction protein beta 3; gap junction protein, beta 3; gap junction protein, beta 3, 31kDa; Gjb3; Gjb-3 |
| Gene | GJB3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 14620, 2707 |
| Formulation | PBS with 0.1% sodium azide; pH 7.4 |
| Immunogen | Synthetic peptide derived from the C-terminal region of mouse connexin 31 protein. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ CD11b Monoclonal Antibody (ICRF44), Super Bright™ 702, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Baboon,Chimpanzee,Cynomolgus Monkey,Human,Rhesus Macaque |
| Host Species | Mouse |
| Conjugate | Super Bright 702 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P11215 |
| Isotype | IgG1 κ |
| Concentration | 5 μL/Test |
| Antigen | CD11b |
| Gene Symbols | ITGAM |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | antigen CD11b (p170); antigen CD11b (p170); macrophage antigen alpha polypeptide; CD11 antigen-like family member B; CD11b; CD11B (p170); CD11b/CD18; cell surface glycoprotein MAC-1 alpha subunit; cell surface glycoprotein MAC-1 subunit alpha; complement component 3 receptor 3 subunit; complement component receptor 3 alpha-a; complement receptor type 3; CR3; CR-3 alpha chain; CR3A; F730045J24Rik; integrin alpha M; integrin alpha-M; integrin subunit alpha M; integrin, alpha M; integrin, alpha M (complement component 3 receptor 3 subunit); ITGAM; Leukocyte adhesion receptor MO1; leukocyte integrin alpha-M chain; LOC100351865; Ly-40; MAC1; Mac-1; Mac-1 alpha; Mac-1 alpha (Mac1A); MAC-1 alpha subunit; MAC1A; Mac-1a; macrophage antigen alpha; macrophage antigen alpha polypeptide; MGC117044; MO1A; Neutrophil adherence receptor; neutrophil adherence receptor alpha-M subunit; SLEB6; unnamed protein product |
| Gene | ITGAM |
| Product Type | Antibody |
| Gene ID (Entrez) | 101866035, 3684, 454069, 714832 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | ICRF44 |
Invitrogen™ BMP5 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P22003, P49003 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | BMP5 |
| Gene Symbols | Bmp5 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | AU023399; BMP; BMP 5; Bmp5; BMP-5; bone morphogenenic protein-5; Bone morphogenetic protein; bone morphogenetic protein 5; MGC34244; se; short ear |
| Gene | Bmp5 |
| Product Type | Antibody |
| Gene ID (Entrez) | 12160, 315824, 653 |
| Formulation | PBS with 5mg BSA and 0.05mg sodium azide |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
CD274 (PD-L1, B7-H1) Monoclonal Antibody (MIH1), APC-eFluor™ 780, eBioscience™, Invitrogen™
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | APC-eFluor 780 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | Q9NZQ7 |
| Concentration | 5 μL/Test |
| Antigen | CD274 (PD-L1, B7-H1) |
| Gene Symbols | Cd274 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | A530045L16Rik; B7 homolog 1; B7-H; B7h1; B7-H1; Cd274; CD274 antigen; CD274 molecule; PDCD1 ligand 1; Pdcd1l1; Pdcd1lg1; Pdl1; PD-L1; pdl-1; Programmed cell death 1 ligand 1; programmed death ligand 1; RGD1566211; sCD274; soluble CD274; soluble PD L1; sPD L1 |
| Gene | Cd274 |
| Product Type | Antibody |
| Gene ID (Entrez) | 29126 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | MIH1 |
CD278 (ICOS) Monoclonal Antibody (7E.17G9), APC, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | APC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2b κ |
| Gene Accession No. | Q9WVS0 |
| Concentration | 0.2 mg/mL |
| Antigen | CD278 (ICOS) |
| Gene Symbols | ICOS |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | Activation-inducible lymphocyte immunomediatory molecule; Ailim; CCLP; CD278; CD28 and CTLA-4-like protein; CD28-related protein 1; CRP-1; CVID1; H4; Icos; inducible costimulator; inducible T cell costimulator; inducible T cell co-stimulator; inducible T-cell costimulator; inducible T-cell co-stimulator; Ly115 |
| Gene | ICOS |
| Product Type | Antibody |
| Gene ID (Entrez) | 54167 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 7E.17G9 |
Invitrogen™ DAB1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Western Blot |
| Form | Liquid |
| Gene Accession No. | O75553, P97318, Q8CJH2 |
| Isotype | IgG |
| Concentration | 0.73 mg/mL |
| Antigen | DAB1 |
| Gene Symbols | DAB1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | AI956902; C630028C02Rik; Dab reelin signal transducer 1; Dab, reelin signal transducer, homolog 1; Dab, reelin signal transducer, homolog 1 (Drosophila); Dab1; DAB1, reelin adaptor protein; disabled 1; disabled homolog 1; RP23-356E21.1; scm; scr; scrambler; yot; yotari |
| Gene | DAB1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 13131, 1600, 266729 |
| Formulation | PBS with 20% glycerol and 0.025% ProClin 300; pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the N-terminus region of human Dab1. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ beta Actin Monoclonal Antibody (15G5A11/E2), Alexa Fluor™ 555
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C, do not freeze |
|---|---|
| Target Species | Human,Mouse,Monkey,Rat |
| Host Species | Mouse |
| Conjugate | Alexa Fluor 555 |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P60709, P60710, P60711 |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | beta Actin |
| Gene Symbols | ACTB |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 0610041G09Rik; AA959943; AAT6; ACT; Act4; Act-4; ACT-5; ACTA; acta1; acta1b; ACTA2; Acta-2; ACTA3; actb; actb.L; actb1; actba; ACTC; actc1; Actc-1; actc1b; ACTE; Actg; ACTG1; Actg2; ACTGE; actin; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 1, skeletal muscle b; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin alpha cardiac muscle 1b; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin, alpha 1, skeletal muscle; actin, alpha 1b, skeletal muscle; actin, alpha 2, smooth muscle, aorta; Actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; actin, alpha cardiac muscle 1b; actin, alpha skeletal muscle; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta 1; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; actin, gamma 1; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha actin 1; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-smooth muscle actin; ASD5; ASMA; a-SMA; Bact; Bact; actin; B-actin; bactin1; bactin1 protein; bactzf; B-ACTZF; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin-1; BRWS1; BRWS2; cardiac muscle alpha actin 1; cardiofunk; cell growth-inhibiting gene 46 protein; Cfk; CFTD; CFTD1; CFTDM; CMD1R; CMH11; cytoplasmic 1; cytoplasmic beta-actin; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; E430023M04Rik; E51; epididymis luminal protein 176; fa27h01; fb83f06; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hm:zeh0631; I79_002310; I79_013242; I79_019066; LVNC4; MPFD; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; PS1TP5-binding protein 1; PS1TP5BP1; SHPM; similar to beta actin; skeletal alpha actin; skeletal alpha1 actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; vascular smooth muscle alpha-actin; VSCM; wu:fa27h01; wu:fb63d03; wu:fb83f06; wu:fd18f05; XELAEV_18045052mg; zeh0631 |
| Gene | ACTB |
| Product Type | Antibody |
| Gene ID (Entrez) | 11461, 60, 81822 |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
| Immunogen | Purified full-length recombinant human beta-actin expressed in E. coli. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 15G5A11/E2 |