Protein Labeling Reagents
Medchemexpress LLC HY-D0938 5mg Medchemexpress, CFSE CAS:150347-59-4 Purity:>98%
Medchemexpress, HY-D0938 5mg CFSE CAS:150347-59-4 CFSE is a fluorescent dye which can track the cell division. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Biocare Medical, LLC Background Sniper - 25 ml
Background Sniper is specifically formulated for superior pH stability and is sodium azide and thimerosal free. It is a universal blocking reagent used for reducing nonspecific background staining often found with immunohistochemistry, ELISA, immunoelectron microscopy and immunogold techniques. Casein has proven to be a superior blocking reagent as compared to serum proteins. It can also be used on an automated staining system.
Lumiprobe Sulfo-Cyanine3 NHS ester | 1424150-38-8 | MFCD28385521 | 5 mg
Sulfo-Cyanine3 NHS ester | Purity: 95% | Mol Wt: 751.91 | 1424150-38-8 | MFCD28385521 | 5 mg
AnaSpec Ninhydrin Test Kit
Ninhydrin Test Kit[This test kit consists of three bottles of reagents. It is used to check if the coupling of a protected amino acid to the amino group of the resin is complete.] (1 each)
Jackson Immuno Research Labs Fluorescein (FITC)-ChromPure Human IgG whole molecule
Fluorescein (FITC)-ChromPure Human IgG whole molecule
AnaSpec AMYLOID (1-40) N-TERMINAL
Beta-Amyloid (1-40), Human[DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV] ; MW 4329.9; (0.5 mg) AB (1-40) together with AB (1-42) are two major C-terminal variants of the AB protein constituting the majority of ABs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.
Biotium CF405S succinimidyl ester
CF Dye Succinimidyl Esters (SE, also known as NHS esters) are amine-reactive fluorescent dyes. SE dyes are commonly used to label antibodies and other proteins on free amine groups, such as lysine residues. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Blue fluorescent CF405S dye has excitation/emission at 404/431 nm.
Biotium CF555, succinimidyl ester
CF Dye Succinimidyl Esters (SE, also known as NHS esters) are amine-reactive fluorescent dyes. SE dyes are commonly used to label antibodies and other proteins on free amine groups, such as lysine residues. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Orange-red fluorescent CF555 dye has excitation/emission at 555/565 nm.