Protein Labeling Reagents
Sigma Aldrich Fine Chemicals Biosciences TRIETHYLAMMONIUM BICARBON500ML
Triethylammonium bicarbonate buffer, 500ml
Lumiprobe Sulfo-Cyanine7 NHS ester | 1603861-95-5 | MFCD28385520 | 1 mg
Sulfo-Cyanine7 NHS ester | Purity: 95% | Mol Wt: 844.05 | 1603861-95-5 | MFCD28385520 | 1 mg
Sino Biological Recombinant Human DDR1 Protein (His & AVI Tag), HPLC-verified, Endotoxin-Free 20 µg
A DNA sequence encoding the Human DDR1 (NP_001189452.2)(Asp21-Thr416) was expressed with a C-terminal polyhistidine tag followed by an AVI tag. The expressed protein was biotinylated in vivo by the Biotin-Protein ligase (BirA enzyme) which is co-expressed.
Bachem 5-Carboxy-fluorescein
5-Carboxy-fluorescein, 76823-03-5, C21H12O7, Mr 376.32, 500mg. 5-FAM, 4-(6-Hydroxy-3-oxo-3H-xanthen-9-yl)-isophthalic acid. Widely used green-fluorescent labeling dye.
New England Biolabs, Inc. SNAP-Cell 647-SiR – 30 nmol
SNAP-Cell 647-SiR is a far-red fluorescent substrate that can be used to label SNAP-tag fusion proteins inside living cells, on cell surfaces, or in vitro.
AdipoGen 6-IAF,Chemical. CAS: 73264-12-7
6-IAF, AdipoGen Life Sciences. Chemical. CAS: 73264-12-7. Formula: C22H14INO6. MW: 515.25. Synthetic. Fluorescent reagent with high selectivity. 73264-12-7
AnaSpec B AMYLOIED (1-40) HILYTE FLUR
Beta-Amyloid (1-40), HiLyte(TM) Fluor 488-labeled, Human[HiLyte(TM) Fluor 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV] ; MW 4686.3; (0.1 mg) This is a fluorescent (HiLyte(TM) Fluor 488)-labeled B-Amyloid peptide, Abs/Em=503/528 nm.
Sigma Aldrich Fine Chemicals Biosciences PKH67 Green Fluorescent Cell Linker Kit for General Cell Membrane Labeling, 1 kit
PKH67 Green Fluorescent Cell Linker Kit for General Cell Membrane Labeling has been used: To label and further investigate the exosomes expelled from cells in triple-negative breast cancer condition, to label apoptotic cells, in order to study the role of alphaνbeta5 receptor in both binding and internalization of apoptotic cells, and in fluorescence imaging.