Protein Labeling Reagents
Biotium Mix-n-Stain™ CF660C Small Ligand Labeling Kit
Mix-n-Stain™ Small Ligand Labeling Kits are designed for rapid labeling of low molecular weight (MW 150 -5000) ligands without a purification step. Suitable ligands or substrates include SNAP-tag, CLIP-tag™ and HaloTag ligand derivatives that have an aliphatic amine. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Far-red fluorescent CF660C dye has excitation/emission at 667/685 nm. It is suitable for labeling ligands for cell surface staining.
Medchemexpress LLC Sulfo-cyanine5-alkyne | 1345823-20-2 | 95.3% | 693.87 g·mol⁻¹ | C36H43N3O7S2 | 10 MG
CY5-YNE (sulfo-Cyanine5-alkyne) is a clickable fluorescent labeling reagent containing an alkyne for copper-catalyzed azide-alkyne cycloaddition (CuAAC). It is used to covalently label peptides, proteins, and oligonucleotides for fluorescence detection and imaging.
- Alkyne functional group enables click chemistry conjugation.
- Excitation 645 nm, emission 670 nm for Cy5-compatible detection.
- Molecular weight 693.87 g·mol⁻¹ and formula C36H43N3O7S2.
- Provided as solid or 10 mM solution in DMSO for flexible use.
- Reported purity ≈95.3%; store protected from light.
![Aat Bioquest 5-TAMRA, SE [5-Carboxytetramethylrhodamine, succinimidyl ester] *CAS#: 150810-68-7*](https://assets.fishersci.com/TFS-Assets/CCG/product-images/default.jpg-250.jpg)
Aat Bioquest 5-TAMRA, SE [5-Carboxytetramethylrhodamine, succinimidyl ester] *CAS#: 150810-68-7*
The single TAMRA isomers are increasingly preferred for labeling peptides and nucleotides because they give better resolution in HPLC purification that is often required in the conjugation processes.
Medchemexpress LLC HY-D0893 5mg Medchemexpress, NSP-SA-NHS CAS:199293-83-9 Purity:>98%
Medchemexpress, HY-D0893 5mg NSP-SA-NHS CAS:199293-83-9 NSP-SA-NHS is a chemiluminescent acridinium ester. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
CPC Scientific FAM-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH (trifluoroacetate salt) 0.5MG
Pituitary hormone N-terminal synthetic fragment that stimulates the corticosteroid synthesis and secretion in the adrenal cortex. This peptide is more active than ACTH in terms of corticosteroid releasing activity in vitro.ONE-LETTER SEQUENCE: Fam-SYSMEHFRWGKPVGKKRRPVKVYPMOLECULAR FORMULA: C157H220N40O37S1MOLECULAR WEIGHT:3291.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [16960-16-0], RESEARCH AREA: HormonalREFERENCES: Y.F.Jacquet, Science, 201, 1032 (1978)
Medchemexpress LLC HY-50938 50mg Medchemexpress, D149 Dye CAS:786643-20-7 Purity:>98%
Medchemexpress, HY-50938 50mg D149 Dye CAS:786643-20-7 D149 Dye is an indoline-based dye, which is a high-extinction-coefficient metal-free organic sensitizer. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC HY-111377 5mg Medchemexpress, Amine-PEG3-Biotin CAS:359860-27-8 Purity:>98%
Medchemexpress, HY-111377 5mg Amine-PEG3-Biotin CAS:359860-27-8 Amine-PEG3-Biotin is used as a signal amplification label. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Apexbio Technology LLC Cyclo (-RGDfK), 5mg. Cas: 161552-03-0 MFCD: MFCD00937400. Inhibitor of αvβ3 integrin
In one study where this peptide was labeled with 125I, it was found to bind specifically and with high affinity to v3 receptors on neovascular blood vessel sections of different major human cancers. The integrin alpha(IIb)beta(3)-specific cyclic hexapeptide contains an Arg-Gly-Asp (RGD) sequence. Other sizes are available. Please inqury us for quote.
Medchemexpress LLC Cyanine5 NHS ester (iodide) | 00-00-0 | 98.0% | C36H42IN3O4 | 10MG
Cyanine5 NHS ester iodide is an amine-reactive, red-emitting fluorescent dye for covalent labeling of primary amino groups in peptides, proteins, and oligonucleotides. Supplied as a solid NHS-ester with an iodide counter-ion, it is characterized for research use with COA, SDS, HNMR, and LCMS documentation to support conjugation and analytical workflows.
- Red emission suitable for near-infrared fluorescence detection.
- Amine-reactive NHS ester for covalent labeling of primary amines.
- High purity supporting consistent conjugation performance.
- Available in multiple small-scale pack sizes for research use.
- Characterized by COA, HNMR, and LCMS documentation.
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.1MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C170H230N43O50MOLECULAR WEIGHT:3676STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.5MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C170H230N43O50MOLECULAR WEIGHT:3676STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
CPC Scientific 5FAM-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 1MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: 5FAM-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C164H256N50O48S4MOLECULAR WEIGHT:3824.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.1MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C219H315N55O62S1MOLECULAR WEIGHT:4742.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1802087-81-5], SYNONYMS: 5-TAMRA-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
Revvity Health Sciences Inc IVISense Cat K 680 FAST Fluorescent Probe
IVISense Cat K 680 FAST Fluorescent Probe