Protein Labeling Reagents
Cayman Chemical CarbaprostacyclIn-bIotIn 100ug
An affinity probe which allows carbaprostacyclin to be detected in complexes with transmembrane receptors and/or nucleic or protein binding partners
Aat Bioquest Fluorescein-5-maleimide *CAS 75350-46-8*
Maleimides are among the most frequently used reagents for thiol modification. In most proteins, the site of reaction is at cysteine residues that either are intrinsically present or resulted from reduction of cystines.
CPC Scientific 5FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.5MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: 5FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C166H219N41O52MOLECULAR WEIGHT:3620.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.1MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C170H230N43O50MOLECULAR WEIGHT:3676STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
CPC Scientific FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.5MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C215H305N53O64S1MOLECULAR WEIGHT:4688.2STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1678416-08-4], SYNONYMS: 5-FAM-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
![Aat Bioquest Tide Fluor™ 3 maleimide [TF3 maleimide] *Superior replacement for Cy3*](https://assets.fishersci.com/TFS-Assets/CCG/product-images/501953129.JPG-250.jpg)
Aat Bioquest Tide Fluor™ 3 maleimide [TF3 maleimide] *Superior replacement for Cy3*
Tide Fluor™ 3 (TF3) family has the spectral properties essentially identical to those of Cy3. Compared to Cy3 probes TF3 family has much stronger fluorescence and higher photostability.
Aat Bioquest 6-TAMRA cadaverine
6-TAMRA cadaverine is a building block for developing fluoresceinated bioconjugates. It is also a fluorescent transglutaminase substrate to label proteins by transaminidation.
![eMolecules Broadpharm / Cy7 Azide / 1mg / 713699861 / BP-28119 / / / [null] / 1083.320 / C50H62N6O13S4](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502463937.JPG-250.jpg)
eMolecules Broadpharm / Cy7 Azide / 1mg / 713699861 / BP-28119 / / / [null] / 1083.320 / C50H62N6O13S4
Broadpharm / Cy7 Azide / 1mg / 713699861 / BP-28119 / / / [null] / 1083.320 / C50H62N6O13S4
![eMolecules Broadpharm / sulfo-Cy75 maleimide / 1mg / 761705736 / BP-28927 / / / [null] / 1205.520 / C51H51K3N4O15S4](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502461280.JPG-250.jpg)
eMolecules Broadpharm / sulfo-Cy75 maleimide / 1mg / 761705736 / BP-28927 / / / [null] / 1205.520 / C51H51K3N4O15S4
Broadpharm / sulfo-Cy75 maleimide / 1mg / 761705736 / BP-28927 / / / [null] / 1205.520 / C51H51K3N4O15S4
![eMolecules Broadpharm / BDP TMR tetrazine / 1mg / 761705833 / BP-28952 / / / [null] / 581.430 / C31H30BF2N7O2](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502460557.PNG-250.jpg)
eMolecules Broadpharm / BDP TMR tetrazine / 1mg / 761705833 / BP-28952 / / / [null] / 581.430 / C31H30BF2N7O2
Broadpharm / BDP TMR tetrazine / 1mg / 761705833 / BP-28952 / / / [null] / 581.430 / C31H30BF2N7O2
Cayman Chemical JWH 018 2-naphthyl Isomer 5mg
Differs structurally from JWH 018 by having the naphthyl group attached at the 2' position
Cayman Chemical AM694 4-Iodo Isomer 5mg
An analog of AM694; intended for forensic and research applications