Protein Labeling Reagents
Medchemexpress LLC (±)-ANAP hydrochloride | 2308035-47-2 | 98.5% | 308.76 | C15H17ClN2O3 | 10 MG
(±)-ANAP hydrochloride is a fluorescent, unnatural amino-acid analog of prodan used as an environment-sensitive probe in biochemical and biophysical studies. It displays polarity-dependent changes in fluorescence intensity and emission wavelength, allowing monitoring of local microenvironments when incorporated site-specifically into peptides or proteins. The compound is supplied as a solid hydrochloride salt with storage recommendations to minimize exposure to moisture and light.
- Sensitive to polarity with changes in intensity and emission wavelength.
- Suitable for site-specific incorporation into peptides and proteins.
- Enables monitoring of local microenvironmental changes.
- High purity appropriate for research applications.
- Stable as a solid; store sealed away from moisture and light at 4°C.
- Available in small package sizes for screening and synthesis.
CPC Scientific FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.5MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C215H305N53O64S1MOLECULAR WEIGHT:4688.2STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1678416-08-4], SYNONYMS: 5-FAM-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
Biotium 5-(AND-6)-CARBOXYTetramethylrhodamine SU
5(6)-TAMRA SE (full name: 5-(and-6)-Carboxytetramethylrhodamine succinimidyl ester (mixed isomers)) is the amine reactive form of TAMRA, one of the most commonly used red fluorescent dyes. The succinimidyl ester reacts readily with primary or secondary amines under mild conditions. Properties: Ex/Em (MeOH) = 540/565 nm; e = 95,000; Red solid soluble in DMF or DMSO; Store at -20°C and protect from light; C 29 H 25 N 3 O 7; MW: 527.5; [150408-83-6]
Cell Structure Labeling Immunocytochemistry Kit, ECM Biosciences
The cell structure labeling kit can be used to identify important cell structures found in eukaryotic cells. The kit includes a panel of antibodies that detect the following cell structures:Actin Filaments = Phalloidin:FITC Cell Junctions = β-catenin Focal Adhesions= PaxillinIntermediate Filaments = VimentinMicrotubules = α-TubulinNuclear Envelope = Nucleoporin p62 Applications: ICC, IHC; Species Reactivity: Hu, Rt, Ms
Revvity Health Sciences Inc HTRF Anti-Europium TBP Maleimide Labeling Reagent, 1 mg
HTRF Anti-Europium TBP Maleimide Labeling Reagent, 1 mg
Kyfora Bio Stains-all 5g
Stains-all is a carbocyanine dye that can be used to stain DNA and RNA as well as anionic proteins and polysaccharides In buffer solution stains-all has an absorption maxima near 570 nm and an emission maxima near 650 nm
Medchemexpress LLC HY-D0893 5mg Medchemexpress, NSP-SA-NHS CAS:199293-83-9 Purity:>98%
Medchemexpress, HY-D0893 5mg NSP-SA-NHS CAS:199293-83-9 NSP-SA-NHS is a chemiluminescent acridinium ester. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Revvity Health Sciences Inc HTRF Anti-Europium NHS Labeling Reagent, 100 µg
HTRF Anti-Europium NHS Labeling Reagent, 100 µg
Biocare Medical, LLC Romulin AEC Chromogen Kit - 500 ml
AEC is a widely used chromogen for immunohistochemical procedures. In the past, AEC chromogens required a water-soluble mounting media because it was soluble in organic solvents. Romulin AEC from Biocare produces a reddish-orange stain. However, it is not soluble in alcohol or xylene-and can be coverslipped just like DAB. It does not fade with permanent mounting media such as PermountTM. When in the presence of a peroxidase enzyme, Romulin AEC produces a reddish-orange stain. This product comes in a 4-component system consisting of ready-to-use buffer, stabilizer, chromogen and hydrogen peroxide.
Biotium CF488A, Aminooxy
Aminooxy dyes have an aminooxy reactive group, which can be used to label a target molecule with an aldehyde or ketone group. An aminooxy group readily reacts with an aldehyde or ketone group to form a stable linkage without the use of a reducing agent. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Green fluorescent CF488A dye has excitation/emission at 490/515 nm.
Vector Laboratories NEUROBIOTIN Tracer
NEUROBIOTIN Tracer (SP-1120) is an amino derivative of biotin that can be used as an intracellular label for cells, particularly neurons. It is used for visualizing neural architecture and for the identification of gap junction coupling. Can be used in many types of preparations including in vivo, whole mounts, slice preparations, or cultured cells - Can be delivered by many routes such as intracellular electrodes, microinjection, cut-loading, or scrape-loading - Can be detected using avidin or streptavidin systems with either chromogenic or fluorescence visualization methods
Medchemexpress LLC HY-50938 50mg Medchemexpress, D149 Dye CAS:786643-20-7 Purity:>98%
Medchemexpress, HY-50938 50mg D149 Dye CAS:786643-20-7 D149 Dye is an indoline-based dye, which is a high-extinction-coefficient metal-free organic sensitizer. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
Biocare Medical, LLC Reveal Decloaker, 10X - 500 ml
Reveal Decloaker is a heat retrieval solution that is suitable for most antibody-antigen staining and reduces non-specific background staining, blocks endogenous peroxidase and removes mercury crystals. Reveal Decloaker can be used with Biocare's digital electric pressure cooker (Decloaking Chamber), a steamer, a water bath, or a microwave oven. For many antibodies, titers are doubled and background staining is significantly reduced when compared to citrate buffer, pH 6.0. Reveal Decloaker incorporates Assure technology, a color-coded high temperature pH indicator solution. The end-user is assured by visual inspection that the solution is at the correct dilution and pH. This product is specially formulated for superior pH stability at high temperatures and will help prevent the possibility of losing pH sensitive antigens. Reveal Decloaker is non-toxic, non-flammable, odorless and sodium azide and thimerosal free.
Biotium Mix-n-Stain™ CF660C Small Ligand Labeling Kit
Mix-n-Stain™ Small Ligand Labeling Kits are designed for rapid labeling of low molecular weight (MW 150 -5000) ligands without a purification step. Suitable ligands or substrates include SNAP-tag, CLIP-tag™ and HaloTag ligand derivatives that have an aliphatic amine. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Far-red fluorescent CF660C dye has excitation/emission at 667/685 nm. It is suitable for labeling ligands for cell surface staining.