Protein Purification
MilliporeSigma™ Calbiochem™ Caspase-1/4 Inhibitor, VX-765
A cell-permeable prodrug that upon conversion to its active form inhibits caspase-1 and 4 activity (Ki = 800 pM and 600 pM, respectively).
Sartorius Vivapure™ LentiSELECT 500 Purification and Concentration Kit
Fast purification of up to 3 x109 viral particles
MilliporeSigma™ Calbiochem™ Caspase-3 Inhibitor I, Cell-Permeable
The Caspase-3 Inhibitor I, Cell-Permeable controls the biological activity of Caspase-3. This small molecule/inhibitor is primarily used for Cancer applications.
MilliporeSigma™ Calbiochem™ Histone Methyltransferase EZH2 Inhibitor, DZNep
Histone Methyltransferase EZH2 Inhibitor, DZNep, CAS 120964-45-6, is a cell-permeable inhibitor of EZH2-mediated trimethylation of K27 on histone H3.
MilliporeSigma™ Calbiochem™ Cdk1 Inhibitor IV, RO-3306
RO-3306 is a cell-permeable, potent and ATP-competitive inhibitor of Cdk1 (Ki = 35 nM and 110 nM for Cdk1/B1 and Cdk1/A, respectively).
MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A
MilliporeSigma™ Calbiochem™ InSolution™ NF-κB Activation Inhibitor
The InSolution™ NF-κB Activation Inhibitor controls the biological activity of NF-κB. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.
Thermo Scientific™ CaptureSelect™ IgG-CH1 Ligand Leakage ELISA
Thermo Scientific™ CaptureSelect™ IgG-CH1 Ligand Leakage ELISA is designed to detect possible leached ligand of antibodies or antibody fragments purified using CaptureSelect IgG-CH1 Affinity Matrix.
Thermo Scientific™ CaptureSelect™ FcXP Ligand Leakage ELISA
Thermo Scientific™ CaptureSelect™ FcXP Ligand Leakage ELISA is designed to detect possible leached ligand of antibodies or antibody fragments purified using CaptureSelect FcXP Affinity Matrix.
MilliporeSigma™ Calbiochem™ PKCθ/δ Inhibitor
A cell-permeable pyridinecarbonitrile compound that acts as a potent, ATP-competitive (Ki = 79 nM, using PKCθ KD in coupled PK/LDH assays), and isozyme-selective PKCθ inhibitor (IC50 = 70nM) with much reduced potency against other novel PKCs (IC50
MilliporeSigma™ Calbiochem™ Diaphanous (mDia)-related Formin Agonist, IMM01
An agonist of mammalian Diaphanous (mDia)-related formins that disrupts diaphanous inhibitory domain (DID) and diaphanous autoregulatory domain (DAD) interaction (IC50 = 140 nM).
Thermo Scientific™ CarboxyLink™ Immobilization Kit, 2 mL
Covalently immobilize peptide antigens and other carboxylate ligands for affinity purification using DADPA-activated agarose beads and EDC crosslinker.
MilliporeSigma™ Calbiochem™ RNA Polymerase III Inhibitor
RNA Polymerase III Inhibitor, CAS 577784-91-9, is a cell-permeable inhibitor of RNA Polymerase III (IC50 = 27 and 32 μM for human and S. cerevisiae RNA Pol III, respectively).
MilliporeSigma™ Calbiochem™ Aminopeptidase N/CD13 Inhibitor
The Aminopeptidase N/CD13 Inhibitor controls the biological activity of Aminopeptidase N/CD13. This small molecule/inhibitor is primarily used for Neuroscience applications.
MilliporeSigma™ Calbiochem™ α,β-methylene ATP
A metabolically stable and selective P2X purinergic receptor agonist (pEC50