Protein Purification
Invitrogen™ MagniSort™ Mouse CD45.2 Positive Selection Kit
Designed for the magnetic separation of CD45.2+ cells by positive selection. It has been optimized for the isolation of CD45.2+ cells from mouse spleens or lymph nodes utilizing a biotinylated Anti-Mouse CD45.2 antibody and streptavidin-coated magnetic beads.
Invitrogen™ MagniSort™ Human pan-Monocyte Enrichment Kit
Designed for the magnetic separation of conventional CD14+ and unconventional CD16+CD14- monocytes by negative selection.
MilliporeSigma™ Calbiochem™ InSolution™ APT1 Inhibitor, palmostatin B
A 50 mM (2 mg/106.23 μL) sterile-filtered solution of APT1 Inhibitor, palmostatin B in DMSO.
MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A
.jpg-250.jpg)
MilliporeSigma™ Calbiochem™ Nefazodone Hydrochloride
A potent 5-HT2A receptor antagonist (Kd = 26nM), with moderate affinity for the alpha1-adrenergic receptor (Kd = 48nM) and 5-HT1A receptor
MilliporeSigma™ Calbiochem™ Salvinorin A
A highly potent and selective non-alkaloid positive allosteric modulator of κ-opioid receptors (Ki
MilliporeSigma™ Calbiochem™ Loperamide Hydrochloride
A very potent and highly selective peripheral resctrictedμ-opioid receptor agonist (Ki = 2
MilliporeSigma™ Calbiochem™ SNX-482
A peptidyl toxin from venom of African tarantula, Hysterocrates gigas that acts as a high affinity, reversible blocker of Cav2.3 (α1E, R-type) channels (IC50 = 15-30 nM).
Invitrogen™ MagniSort™ Mouse CD11c Positive Selection Kit
Designed for the magnetic separation of CD11c+ cells by positive selection. It has been optimized for the isolation of CD11c+ cells from mouse spleens utilizing a biotinylated Anti-Mouse CD11c antibody and streptavidin-coated magnetic beads.
Thermo Scientific Chemicals Leupeptin, 90%, synthetic
CAS: 103476-89-7 Molecular Formula: 0·5 H2O4S
MilliporeSigma™ Calbiochem™ p-APMSF, Hydrochloride
Alternative to DFP and PMSF.
MilliporeSigma™ Calbiochem™ APT1 Inhibitor, palmostatin B
The APT1 Inhibitor, palmostatin B controls the biological activity of APT1.
MilliporeSigma™ Upstate Streptavidin, Agarose Conjugate
Used for purification of biotinylated macromolecules.
Thermo Scientific™ POROS™ EP 20 μm Column, 4.6 x 100 mm, 1.7 mL
Thermo Scientific™ POROS™ Prepacked Immobilized Epoxide Affinity Column. POROS EP is based on an epoxide functional group designed for the immobilization of proteins through free amine groups.
Thermo Scientific™ POROS™ EP 20 μm Column, 4.6 x 50 mm, 0.8 mL
Thermo Scientific™ POROS™ Prepacked™ Immobilized Epoxide Affinity Column is based on an epoxide functional group designed for the immobilization of proteins through free amine groups.