
Immunoassay and Immunology Controls
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (2)
- (3)
- (1)
- (12)
- (1)
- (1)
- (1)
- (2)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (12)
- (7)
- (5)
- (6)
- (4)
- (6)
Filtered Search Results

SeraCare™ HCV RNA Linearity Panel
Serial dilutions of high titer HCV RNA plasma in HCV RNA negative pooled plasma
Invitrogen™ Human Thromboxane synthase (aa 276-331) Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | RDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEI |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human Thromboxane synthase (aa 276-331) Control Fragment |
Recombinant | Recombinant |
TBXAS Monoclonal Antibody (OTI1A9), TrueMAB™, OriGene
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Form | Liquid |
Isotype | IgG1 |
Gene Accession No. | P24557 |
Concentration | 0.86 mg/mL |
Antigen | TBXAS |
Regulatory Status | RUO |
Gene | TBXAS1 |
Gene ID (Entrez) | 6916 |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | OTI1A9 |
TBXAS Monoclonal Antibody (OTI1H9), TrueMAB™, OriGene
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Antigen | TBXAS |
---|---|
Regulatory Status | RUO |
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Form | Liquid |
Classification | Monoclonal |
Isotype | IgG2b |
Primary or Secondary | Primary |
Concentration | 1 mg/mL |
Clone | OTI1H9 |
TBXAS Monoclonal Antibody (OTI1H1), TrueMAB™, OriGene
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Form | Liquid |
Isotype | IgG2b |
Gene Accession No. | P24557 |
Concentration | 0.63 mg/mL |
Antigen | TBXAS |
Regulatory Status | RUO |
Gene | TBXAS1 |
Gene ID (Entrez) | 6916 |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | OTI1H1 |
TBXAS Monoclonal Antibody (OTI1A12), TrueMAB™, OriGene
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Form | Liquid |
Isotype | IgG2b |
Gene Accession No. | P24557 |
Concentration | 0.8 mg/mL |
Antigen | TBXAS |
Regulatory Status | RUO |
Gene | TBXAS1 |
Gene ID (Entrez) | 6916 |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | OTI1A12 |
TBXAS Monoclonal Antibody (OTI1C3), TrueMAB™, OriGene
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Antigen | TBXAS |
---|---|
Regulatory Status | RUO |
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Form | Liquid |
Classification | Monoclonal |
Isotype | IgG2a |
Primary or Secondary | Primary |
Concentration | 0.63 mg/mL |
Clone | OTI1C3 |
TBXAS Monoclonal Antibody (OTI1B8), TrueMAB™, OriGene
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Antigen | TBXAS |
---|---|
Regulatory Status | RUO |
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Form | Liquid |
Classification | Monoclonal |
Isotype | IgG2a |
Primary or Secondary | Primary |
Concentration | 0.94 mg/mL |
Clone | OTI1B8 |
Biolegend Veri-Cells™ Leukocytes
Veri-Cells™ Leukocytes Apps: FC, ICFC; Size: 10 tests

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Maine Molecular Quality Controls Inc MAINE MOLECULAR RP2.1 CONTROL
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
BioFire RP2.1/RP2.1plus Control Panel M441 is intended for use as an external positive and negative assayed quality control to monitor the performance of in vitro laboratory nucleic acid testing procedures for the qualitative detection of viruses and bacteria on the BioFire Respiratory Panel 2.1 (RP2.1), BioFire Respiratory Panel 2.1plus (RP2.1plus) and BioFire Respiratory Panel 2.1-EZ (RP2.1-EZ) assays performed on the BioFire FilmArray systems. BioFire RP2.1/RP2.1plus Positive control is composed of synthetic RNA transcripts specifically designed for and intended to be used solely with the BioFire RP2.1, BioFire RP2.1plus and BioFire RP2.1-EZ assays. The BioFire RP2.1/RP2.1plus Control Panel M441 is comprised of 12 single use tubes, 6 tubes of BioFire RP2.1/RP2.1plus Positive and 6 tubes of BioFire RP2.1/RP2.1plus Negative, 300µL each.

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cygnus Technologies P.pastoris HCP Standards Set (A-F), 1mL/vial Antigens 1 ml
P.pastoris HCP Standards Set (A-F), 1mL/vial Antigens 1 ml

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More

Maine Molecular Quality Controls Inc GI PANEL
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
The FilmArray GI Control Panel M238 is intended for in vitro use as a quality control to monitor the detection and identification of multiple gastrointestinal pathogens (viruses, bacteria, and protozoa) as performed by the FilmArray Gastrointestinal (GI) Panel assay on the FilmArray instrument. Detection of the viruses, bacteria and protozoa is an important aid to the diagnosis of gastrointestinal illness. The FilmArray GI Control Panel M238 is comprised of 12 tubes, 200µL each, containing synthetic RNA suspended in a non-infectious solution of buffers, preservatives and stabilizers.

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Maine Molecular Quality Controls Inc FilmArray BCID2 Control Panel M416
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
The FilmArray BCID2 Control Panel M416 is intended for use as an external positive and negative assayed quality control to monitor the performance of in vitro laboratory nucleic acid testing procedures for the qualitative detection of antimicrobial resistance genes, gram positive bacteria, gram negative bacteria, and yeast pathogens on the BioFire Blood Culture Identification 2 (BCID2) Panel on the BioFire FilmArray systems. FilmArray BCID2 Control Panel M416 is comprised of 2 controls, FilmArray BCID2 Positive Control and FilmArray BCID2 Negative Control. FilmArray BCID2 Control Panel M416 is comprised of 12 tubes, 6 tubes of positive control and 6 tubes of negative control, 200μL each.

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Maine Molecular Quality Controls Inc INTROL ME CTROL PANEL
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
BioFire ME Control Panel M262 is intended for in vitro use as a quality control to monitor the performance of laboratory nucleic acid testing procedures for the qualitative detection of Escherichia coli K1, Haemophilus influenzae, Listeria monocytogenes, Neisseria meningitidis, Streptococcus agalactiae, Streptococcus pneumoniae, Cytomegalovirus, Enterovirus, Herpes simplex virus 1, Herpes simplex virus 2, Human herpesvirus 6, Human parechovirus, Varicella zoster virus and Cryptococcus neoformans/gattii with the BioFire FilmArray Meningitis/Encephalitis (ME) Panel assay performed on BioFire FilmArray systems. BioFire ME Control Panel M262 is composed of 2 controls, BioFire ME Positive M263 and BioFire ME Negative M264. BioFire ME Positive M263 contains synthetic RNA corresponding to genome segments of pathogens. BioFire ME Negative M264 contains non-target RNA.

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More