Cell Culture Media, Supplements, and Reagents
eMolecules 70907-93-6 | Medchem Express | Ethylmalonic acid-d3 | 1mg | 784544273 | HY-34740S | 135.133 | C5H8O4
Medchem Express | Ethylmalonic acid-d3 | 1mg | 784544273 | HY-34740S | 70907-93-6 | 135.133 | C5H8O4
Selleck Chemical LLC SW-044248
SW-044248 is a non-canonical Top1 inhibitor with a pattern of selective toxicity for NSCLC cells
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-Ala-Thr-Ser-OH (trifluoroacetate salt) 1MG
A parathyroid hormone (PTH)-related peptide (1-40), human.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSMOLECULAR FORMULA: C207H334N66O58MOLECULAR WEIGHT:4675.34STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [120298-73-9], SYNONYMS: pTH-Related Protein (1-40) (human, mouse, rat)RESEARCH AREA: Osteoporosis
Teknova 30mg/mL Gentamicin, 1mL, 100 Tubes per Pack, Sterile. 3 Pack.
Premade antibiotic solutions are ready-to-use as a supplement for your tissue culture, bacteria media or other specific needs. Antibiotics are often used in cell culture to prevent contamination, maintain aseptic conditions, or select for cells containing genetic modifications.
Cayman Chemical NSC 23005 (sodium salt), Purity: ≥98%, CAS: 1796596-46-7, 5 mg
An inhibitor of p18 that promotes expansion of murine and human HSCs; promotes HSC expansion in a single-cell in vitro culture assay using isolated murine bone marrow cells (ED50 = 5.21 nM); increases HSC proliferation without affecting differentiation, inducing cytotoxicity, or affecting leukemia cell proliferation
Crescent Chemical Co Inc OXACILLIN NA SALT H2O 100MG
Oxacillin sodium salt hydrate Pharma./veter. comp. (WS) CAS 7240-38-2 Molecular Weight - 441.4334 Storage - +5°C Catalog Num - DRE-C15755100 chemical
Miltenyi Biotec, Inc. CytoBox Mo-DC
Recombinant human granulocyte macrophage colony-stimulating factor (500 µg) and recombinant human interleukin 4 (2×100 µg)
Meso Scale Discovery R-PLEX Human PDGF-A ASYQP
The R-PLEX Human PDGF-AA Assay Kit from Meso Scale Discovery is a multiplex immunoassay that measures PDGF-AA in human serum plasma and cell culture supernatants It utilizes electrochemiluminescence (ECL) detection technology and provides high sensitivity broad dynamic range and intra- and inter-assay precision This assay requires 50 L or less sample volume and can assay up to 80 samples in duplicates in 3 5 hours The lower limit of detection is 1 5 pg/mL
Cayman Chemical NSC 319726, Purity: ≥95%, CAS: 71555-25-4, 10 mg
A p53 reactivator; selectively inhibits growth of human tumor cell lines containing mutant p53 over those containing wild-type p53 (IC50s = 0.1-1 and >10 μM, respectively); induces apoptosis in TOV112D (p53R175H), but not OVCAR3 (p53R248W) or SKOV3 (p53-/-), cells at a concentration of 1 μM; restores a wild-type conformation to human p53175 and mouse p53R172 mutant proteins and induces expression of p53 target genes in TOV112D cells; inhibits tumor growth in TOV112D, but not H460 (p53+/+), mouse xenograft model when administered at a dose of 1 mg/kg; has broad-spectrum antifungal activity (MIC50s = 0.1-2 μg/ml against a panel of pathogenic fungi) with >800-fold selectivity for fungi over human HUH-7 and HepG2 cells
Meso Scale Discovery U-PLEX Mouse TGF-B2 ASYQP
The Meso Scale Discovery U-PLEX Mouse TGF-beta 2 Assay Kit is an electrochemiluminescent immunoassay for measuring TGF-beta 2 in mouse serum plasma and cell culture supernatants It uses MSD s SECTOR Imager for high sensitivity and a broad dynamic range The kit includes a 96-well plate with capture antibody detection antibody Read Buffer Calibrator Diluent and lyophilized U-PLEX Calibrator Sensitivity is 0 3 pg/mL with an upper limit of 10 000 pg/mL The assay time is 3 5 hours enabling rapid sensitive quantification of TGF-beta 2 from mouse samples
Bioworld HUMAN KERATINOCYE GROWTH FA
HUMAN KERATINOCYE GROWTH FACTOR (RECOMBINANT): Recombinant Human Keratinocyte Growth Factor (KGF) Source: E.Coli Background: KGF is a potent specific mitogen for many epithelial cells but not for fibroblasts and endothelial cells. KG...
Bioworld HUMAN FIBROBLAST GROWTH FAC
HUMAN FIBROBLAST GROWTH FACTOR-BASIC (RECOMBINANT): Recombinant Human Fibroblast Growth Factor-basic (FGF-2) Source: E. coli Background: bFGF is a single-chain polypeptide growth factor that plays a significant role in the process of...
Bioworld HUMAN GRO-BETA/MIP-2 (CXCL2
HUMAN GRO-BETA/MIP-2 (CXCL2), (RECOMBINANT): Recombinant Human GRO-Beta (CXCL2) - GRO-beta Source:E.Coli Background: Three human MGSA/GRO genes encode 3 highly related chemokines, MGSA/GRO alpha, -beta and -gamma. All 3 MGSA/GRO prot...
Bioworld HUMAN FIBROBLAST GROWTH FAC
HUMAN FIBROBLAST GROWTH FACTOR-22 (RECOMBINANT): Recombinant Human Fibroblast Growth Factor-22 (FGF-22) Source: E.Coli Background : Description Recombinant Human FGF-22 produced in E.Coli is a single, non-glycosylated polypeptide c...