Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 5-HT2B Antibody, Novus Biologicals™

5-HT2B Antibody, Novus Biologicals™
SDP

Catalog No. p-200082211 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP257832 100 μL
NB393758 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP257832 Supplier Novus Biologicals Supplier No. NBP257832
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

5-HT2B Polyclonal specifically detects 5-HT2B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen 5-HT2B
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias 5-HT(2B), 5-HT-2B, 5-HT2B5-HT 2B receptor, 5-hydroxytryptamine (serotonin) receptor 2B, 5-hydroxytryptamine 2B receptor, 5-hydroxytryptamine receptor 2B, Serotonin receptor 2B
Gene Symbols HTR2B
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQS
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission
Primary or Secondary Primary
Gene ID (Entrez) 3357
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.