Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Agpat4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Agpat4 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17987020
|
Novus Biologicals
NBP17987020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179870
|
Novus Biologicals
NBP179870 |
100 μL |
Each for $487.50
|
|
|||||
Description
Agpat4 Polyclonal specifically detects Agpat4 in Human samples. It is validated for Western Blot.Specifications
| Agpat4 | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acidacyltransferase, delta), 1-AGP acyltransferase 4,1-acylglycerol-3-phosphate O-acyltransferase 4,1-AGPAT 4, dJ473J16.2,1-acyl-sn-glycerol-3-phosphate acyltransferase delta, EC 2.3.1.51, LPAAT-delta1-AGPAT4, Lysophosphatidic acid acyltransferase delta, lysophosphatidic acid acyltransferase-delta (LPAAT-delta) | |
| AGPAT4 | |
| IgG | |
| 44 kDa |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Rabbit | |
| Q9NRZ5 | |
| 56895 | |
| Synthetic peptide directed towards the middle region of human AGPAT4The immunogen for this antibody is AGPAT4 (NP_064518). Peptide Sequence: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title