AK2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154639

Catalog No. NBP154639

Description

AK2 Polyclonal specifically detects AK2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AK2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: adenylate kinase 2, adenylate kinase 2, mitochondrial, adenylate kinase isoenzyme 2, mitochondrial, ADK2, AK 2, ATP-AMP transphosphorylase 2, EC 2.7.4, EC 2.7.4.3
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Bovine: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P54819
• Gene Symbols: AK2
• Immunogen: Synthetic peptides corresponding to AK2(adenylate kinase 2) The peptide sequence was selected from the N terminal of AK2. Peptide sequence MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 204
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG