Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AK2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15463920UL
Description
AK2 Polyclonal specifically detects AK2 in Human samples. It is validated for Western Blot.Specifications
| AK2 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| P54819 | |
| AK2 | |
| Synthetic peptides corresponding to AK2(adenylate kinase 2) The peptide sequence was selected from the N terminal of AK2. Peptide sequence MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML. | |
| Protein A purified | |
| RUO | |
| 204 | |
| Store at -20C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| adenylate kinase 2, adenylate kinase 2, mitochondrial, adenylate kinase isoenzyme 2, mitochondrial, ADK2, AK 2, ATP-AMP transphosphorylase 2, EC 2.7.4, EC 2.7.4.3 | |
| Rabbit | |
| 26 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction