Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | AK2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154639
|
Novus Biologicals
NBP154639 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP15463920
|
Novus Biologicals
NBP15463920UL |
20 μL | N/A | N/A | N/A | ||||
Description
AK2 Polyclonal specifically detects AK2 in Human samples. It is validated for Western Blot.Specifications
| AK2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| adenylate kinase 2, adenylate kinase 2, mitochondrial, adenylate kinase isoenzyme 2, mitochondrial, ADK2, AK 2, ATP-AMP transphosphorylase 2, EC 2.7.4, EC 2.7.4.3 | |
| AK2 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| P54819 | |
| 204 | |
| Synthetic peptides corresponding to AK2(adenylate kinase 2) The peptide sequence was selected from the N terminal of AK2. Peptide sequence MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML. | |
| Primary | |
| 26 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title