Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. alcohol dehydrogenase 1A Antibody, Novus Biologicals™

alcohol dehydrogenase 1A Antibody, Novus Biologicals™
SDP

Catalog No. p-7107650 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157671 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157671 Supplier Novus Biologicals Supplier No. NBP157671
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

alcohol dehydrogenase 1A Polyclonal specifically detects alcohol dehydrogenase 1A in Human samples. It is validated for Western Blot.

Specifications

Antigen alcohol dehydrogenase 1A
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P07327
Gene Alias ADH, alpha subunit, ADH1alcohol dehydrogenase 1A, alcohol dehydrogenase 1 (class I), alpha polypeptide, alcohol dehydrogenase 1A (class I), alpha polypeptide, Alcohol dehydrogenase subunit alpha, aldehyde reductase, EC 1.1.1, EC 1.1.1.1
Gene Symbols ADH1A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ADH1A(alcohol dehydrogenase 1A (class I), alpha polypeptide) The peptide sequence was selected from the N terminal of ADH1A (NP_000658). Peptide sequence: ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA.
Molecular Weight of Antigen 40 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 124
Test Specificity Expected identity based on immunogen sequence: Human: 100%.
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Canine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.