Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

alcohol dehydrogenase 1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	alcohol dehydrogenase 1A
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP157671 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP157671	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

alcohol dehydrogenase 1A Polyclonal specifically detects alcohol dehydrogenase 1A in Human samples. It is validated for Western Blot.

Specifications

Antigen	alcohol dehydrogenase 1A
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	P07327
Gene ID (Entrez)	124
Immunogen	Synthetic peptides corresponding to ADH1A(alcohol dehydrogenase 1A (class I), alpha polypeptide) The peptide sequence was selected from the N terminal of ADH1A (NP_000658). Peptide sequence: ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	ADH, alpha subunit, ADH1alcohol dehydrogenase 1A, alcohol dehydrogenase 1 (class I), alpha polypeptide, alcohol dehydrogenase 1A (class I), alpha polypeptide, Alcohol dehydrogenase subunit alpha, aldehyde reductase, EC 1.1.1, EC 1.1.1.1
Gene Symbols	ADH1A
Isotype	IgG
Molecular Weight of Antigen	40 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

alcohol dehydrogenase 1A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents