Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aldehyde dehydrogenase 5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$343.50 - $573.00
Specifications
Antigen | Aldehyde dehydrogenase 5 |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Aldehyde dehydrogenase 5 Polyclonal antibody specifically detects Aldehyde dehydrogenase 5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
Aldehyde dehydrogenase 5 | |
Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Cancer, Endocrinology, Signal Transduction | |
PBS, pH 7.2, 40% glycerol | |
219 | |
IgG | |
Affinity purified |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
aldehyde dehydrogenase 1 family, member B1, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase family 1 member B1, ALDH class 2, ALDH5aldehyde dehydrogenase X, mitochondrial, ALDHXacetaldehyde dehydrogenase 5, EC 1.2.1, EC 1.2.1.3, MGC2230, mitochondrial aldehyde dehydrogenase X | |
This antibody was developed against Recombinant Protein corresponding to amino acids: ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title