Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
alpha 1 Mannosidase 1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP237938
Description
alpha 1 Mannosidase 1A Polyclonal specifically detects alpha 1 Mannosidase 1A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
alpha 1 Mannosidase 1A | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
P33908 | |
MAN1A1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK | |
0.1 mL | |
Golgi Apparatus Markers | |
4121 | |
Human | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
Alpha-1,2-mannosidase IA, EC 3.2.1, EC 3.2.1.113, HUMM3, HUMM9, Man(9)-alpha-mannosidase, MAN9, Man9-mannosidase, Mannosidase alpha class 1A member 1, mannosidase, alpha, class 1A, member 1, mannosyl-oligosaccharide 1,2-alpha-mannosidase IA, Processing alpha-1,2-mannosidase IA | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction