Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALS2CR12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17040520UL
Description
ALS2CR12 Polyclonal specifically detects ALS2CR12 in Human samples. It is validated for Western Blot.Specifications
ALS2CR12 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12 | |
Rabbit | |
52 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ALS2CR12 | |
Synthetic peptides corresponding to ALS2CR12(amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12) The peptide sequence was selected from the N terminal of ALS2CR12. Peptide sequence SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSAR | |
Affinity Purified | |
RUO | |
130540 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction