Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ALS2CR12 Antibody, Novus Biologicals™

ALS2CR12 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17040520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17040520 20 μL
NBP170405 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17040520 Supplier Novus Biologicals Supplier No. NBP17040520UL

Description

Rabbit Polyclonal Antibody

ALS2CR12 Polyclonal specifically detects ALS2CR12 in Human samples. It is validated for Western Blot.

Specifications

Antigen ALS2CR12
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12
Gene Symbols ALS2CR12
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ALS2CR12(amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12) The peptide sequence was selected from the N terminal of ALS2CR12. Peptide sequence SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSAR
Molecular Weight of Antigen 52 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 130540
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.