Aminopeptidase P2/XPNPEP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180493

Catalog No. NBP180493

Description

Aminopeptidase P2/XPNPEP2 Polyclonal specifically detects Aminopeptidase P2/XPNPEP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Aminopeptidase P2/XPNPEP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Aminoacylproline aminopeptidase, APP2, EC 3.4.11.9, mAmP, Membrane-bound aminopeptidase P, Membrane-bound AmP, Membrane-bound APP, xaa-Pro aminopeptidase 2, X-Pro aminopeptidase 2, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7512
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_003390
• Gene Symbols: XPNPEP2
• Immunogen: Synthetic peptide directed towards the middle region of human XPNPEP2. Peptide sequence QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Pig: 92%; Rabbit: 92%; Equine: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG