Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aminopeptidase P2/XPNPEP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Aminopeptidase P2/XPNPEP2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Aminopeptidase P2/XPNPEP2 Polyclonal specifically detects Aminopeptidase P2/XPNPEP2 in Human samples. It is validated for Western Blot.Specifications
Aminopeptidase P2/XPNPEP2 | |
Polyclonal | |
Rabbit | |
NP_003390 | |
7512 | |
Synthetic peptide directed towards the middle region of human XPNPEP2. Peptide sequence QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Aminoacylproline aminopeptidase, APP2, EC 3.4.11.9, mAmP, Membrane-bound aminopeptidase P, Membrane-bound AmP, Membrane-bound APP, xaa-Pro aminopeptidase 2, X-Pro aminopeptidase 2, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound | |
XPNPEP2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title