Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aminopeptidase P2/XPNPEP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Aminopeptidase P2/XPNPEP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Aminopeptidase P2/XPNPEP2 Polyclonal specifically detects Aminopeptidase P2/XPNPEP2 in Human samples. It is validated for Western Blot.Specifications
| Aminopeptidase P2/XPNPEP2 | |
| Polyclonal | |
| Rabbit | |
| NP_003390 | |
| 7512 | |
| Synthetic peptide directed towards the middle region of human XPNPEP2. Peptide sequence QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Aminoacylproline aminopeptidase, APP2, EC 3.4.11.9, mAmP, Membrane-bound aminopeptidase P, Membrane-bound AmP, Membrane-bound APP, xaa-Pro aminopeptidase 2, X-Pro aminopeptidase 2, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound | |
| XPNPEP2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title