Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMPK alpha 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | AMPK alpha 2 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15632220
|
Novus Biologicals
NBP15632220UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156322
|
Novus Biologicals
NBP156322 |
100 μL |
Each for $487.50
|
|
|||||
Description
AMPK alpha 2 Polyclonal specifically detects AMPK alpha 2 in Human, Mouse, Rat samples. It is validated for Western Blot.Specifications
| AMPK alpha 2 | |
| Unconjugated | |
| RUO | |
| P54646 | |
| 5563 | |
| Synthetic peptide directed towards the middle region of human PRKAA2 (NP_006243). Peptide sequence: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP. | |
| Primary | |
| 62 kDa |
| Polyclonal | |
| Rabbit | |
| Autophagy, Cancer, Hypoxia, MAP Kinase Signaling, mTOR Pathway, Protein Kinase, Signal Transduction, Translation Control | |
| 5'-AMP-activated protein kinase catalytic subunit alpha-2, AMPK subunit alpha-2, AMPK2, AMPK5'-AMP-activated protein kinase, catalytic alpha-2 chain, AMPK-alpha-2 chain, EC 2.7.11, EC 2.7.11.1, PRKAA, protein kinase, AMP-activated, alpha 2 catalytic subunit | |
| PRKAA2 | |
| IgG | |
| This product is specific to Subunit or Isoform: alpha-2. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title