Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Annexin A4 Antibody, Novus Biologicals™
SDP

Catalog No. p-200045532 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB405607 25 μL
NBP190151 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB405607 Supplier Novus Biologicals Supplier No. NBP19015125UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Annexin A4 Polyclonal specifically detects Annexin A4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Annexin A4
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:200-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P09525
Gene Alias annexin A4, Annexin IV, annexin IV (placental anticoagulant protein II), annexin-4, ANX4Carbohydrate-binding protein p33/p41, Chromobindin-4, chromobindin-4,35-beta calcimedin, DKFZp686H02120, Endonexin I, Lipocortin IV, MGC75105, P32.5, PAP-II, PIG28, Placental anticoagulant protein II, PP4-X, proliferation-inducing gene 28, proliferation-inducing protein 28, Protein II, ZAP36
Gene Symbols ANXA4
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQ
Molecular Weight of Antigen 36 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 307
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.