Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1), DyLight 755, Novus Biologicals™
SDP

Catalog No. NBP234604IR Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP234604IR 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP234604IR Supplier Novus Biologicals Supplier No. NBP234604IR
Only null left
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

DOG1/TMEM16A Monoclonal specifically detects DOG1/TMEM16A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen DOG1/TMEM16A
Applications Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Classification Monoclonal
Clone DG1/447 + DOG-1.1
Conjugate DyLight 755
Dilution Western Blot, Flow Cytometry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Alias ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Gene Symbols ANO1
Host Species Mouse
Immunogen Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6)
Molecular Weight of Antigen 114 kDa
Purification Method Protein A or G purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55107
Test Specificity Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Target Species Human
Content And Storage Store at 4C in the dark.
Form Purified
Isotype IgG1 κ
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.