Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Trim22 Antibody, Novus Biologicals™

Trim22 Antibody, Novus Biologicals™
SDP

Catalog No. NBP181795 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP181795 0.1 mL
NB433677 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP181795 Supplier Novus Biologicals Supplier No. NBP181795
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 5 publications

Trim22 Polyclonal specifically detects Trim22 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen Trim22
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 50 kDa-stimulated trans-acting factor, E3 ubiquitin-protein ligase TRIM22, EC 6.3.2, EC 6.3.2.-, GPSTAF50, RING finger protein 94, RNF94stimulated trans-acting factor (50 kDa), Staf-50, STAF50staf-50, tripartite binding motif 22, tripartite motif containing 22, tripartite motif protein TRIM22, tripartite motif-containing 22, Tripartite motif-containing protein 22
Gene Symbols TRIM22
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 10346
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.