Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

APEG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$382.00 - $610.00

Specifications

Antigen	APEG1
Dilution	Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB430492 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP19013425UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP190134 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP190134	0.1 mL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

APEG1 Polyclonal specifically detects APEG1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	APEG1
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Accession No.	Q15772
Gene ID (Entrez)	10290
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:VYKSVIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTYTVQHQV
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Dilution	Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	aortic preferentially expressed gene 1, Aortic preferentially expressed protein 1, APEG1, BPEG, EC 2.7.11, EC 2.7.11.1, KIAA1297APEG-1, MGC12676, nuclear protein, marker for differentiated aortic smooth muscle anddown-regulated with vascular injury, SPEG complex locus, SPEGalpha, SPEGbeta, striated muscle preferentially expressed protein kinase
Gene Symbols	SPEG
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

APEG1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents