Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARNTL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169032
Description
ARNTL2 Polyclonal specifically detects ARNTL2 in Mouse samples. It is validated for Western Blot.Specifications
ARNTL2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Aryl hydrocarbon receptor nuclear translocator-like protein 2, Basic-helix-loop-helix-PAS protein MOP9, bHLHe6, BMAL2, Brain and muscle ARNT-like 2, Class E basic helix-loop-helix protein 6, CLIF, CYCLE-like factor, Member of PAS protein 9, MOP9, PAS domain-containing protein 9, PASD9, Transcription Factor BMAL2 | |
Rabbit | |
64 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q2VPD4 | |
ARNTL2 | |
Synthetic peptides corresponding to Arntl2 (aryl hydrocarbon receptor nuclear translocator-like 2) The peptide sequence was selected from the C terminal of Arntl2. Peptide sequence PHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWA. | |
Affinity purified | |
RUO | |
56938 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction