Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP159542

ARV1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159542 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159542 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159542 Supplier Novus Biologicals Supplier No. NBP159542
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ARV1 Polyclonal specifically detects ARV1 in Human samples. It is validated for Western Blot.

Specifications

Antigen ARV1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9H2C2
Gene Alias ARV1 homolog (S. cerevisiae), ARV1 homolog (yeast), hARV1, protein ARV1
Gene Symbols ARV1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ARV1(ARV1 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of ARV1 (NP_073623). Peptide sequence: QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD.
Molecular Weight of Antigen 31 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64801
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Bovine: 84%; Goat: 84%; Pig: 84%; Canine: 78%.
Reconstitution Centrifuge vial prior to reconstitution. Reconstitute in 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Pig, Bovine, Canine, Goat, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.