Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Ataxin-2-like protein Antibody, Novus Biologicals™
SDP

Catalog No. p-200057406 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396008 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396008 Supplier Novus Biologicals Supplier No. NBP24874125UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Ataxin-2-like protein Polyclonal antibody specifically detects Ataxin-2-like protein in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown

Specifications

Antigen Ataxin-2-like protein
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias A2DA2RP, A2LG, A2lp, ataxin 2 related protein, ataxin 2-like, Ataxin-2 domain protein, ataxin-2-like protein, Ataxin-2-related protein
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: APISASCPEPPIGSAVPTSSASIPVTSSVSDPGVGSISPASPKISLAPTDVKELSTKEPGRTLEPQELARIAGKVPGLQNEQKRFQLEELRK
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11273
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.