AUH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168920

Catalog No. NBP168920

Description

AUH Polyclonal specifically detects AUH in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: AUH
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 3-methylglutaconyl-CoA hydratase, AU RNA binding protein/enoyl-CoA hydratase, AU RNA binding protein/enoyl-Coenzyme A hydratase, AU RNA-binding protein/enoyl-Coenzyme A hydratase, AU-binding protein/enoyl-CoA hydratase, AU-specific RNA-binding enoyl-CoA hydratase, EC 4.2.1.18, methylglutaconyl-CoA hydratase, mitochondrial
• Host Species: Rabbit
• Molecular Weight of Antigen: 33 kDa
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 549
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9JLZ3
• Gene Symbols: AUH
• Immunogen: Synthetic peptides corresponding to Auh (AU RNA binding protein/enoyl-coenzyme A hydratase) The peptide sequence was selected from the N terminal of Auh. Peptide sequence PRRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNALSKNLLKMLS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.