Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AUH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | AUH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AUH Polyclonal specifically detects AUH in Mouse samples. It is validated for Western Blot.Specifications
| AUH | |
| Polyclonal | |
| Rabbit | |
| Q9JLZ3 | |
| 549 | |
| Synthetic peptides corresponding to Auh (AU RNA binding protein/enoyl-coenzyme A hydratase) The peptide sequence was selected from the N terminal of Auh. Peptide sequence PRRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNALSKNLLKMLS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 3-methylglutaconyl-CoA hydratase, AU RNA binding protein/enoyl-CoA hydratase, AU RNA binding protein/enoyl-Coenzyme A hydratase, AU RNA-binding protein/enoyl-Coenzyme A hydratase, AU-binding protein/enoyl-CoA hydratase, AU-specific RNA-binding enoyl-CoA hydratase, EC 4.2.1.18, methylglutaconyl-CoA hydratase, mitochondrial | |
| AUH | |
| IgG | |
| 33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title