Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AWAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	AWAT1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP159865 View Documents View Product Certificates	Novus Biologicals NBP159865	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

AWAT1 Polyclonal specifically detects AWAT1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	AWAT1
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q58HT5
Gene ID (Entrez)	158833
Immunogen	Synthetic peptides corresponding to AWAT1 (acyl-CoA wax alcohol acyltransferase 1) Antibody(against the N terminal of AWAT1. Peptide sequence NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	acyl-CoA wax alcohol acyltransferase 1, DGA2, DGAT2L3, diacyl-glycerol acyltransferase 2, Diacylglycerol acyltransferase 2, diacylglycerol O-acyltransferase 2-like 3, Diacylglycerol O-acyltransferase 2-like protein 3, EC 2.3.1.75, Long-chain-alcohol O-fatty-acyltransferase 1
Gene Symbols	AWAT1
Isotype	IgG
Molecular Weight of Antigen	38 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

AWAT1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents