Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. B7-H4 Antibody, Novus Biologicals™

B7-H4 Antibody, Novus Biologicals™
SDP

Catalog No. NB397705 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB397705 25ul
NBP230536 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB397705 Supplier Novus Biologicals Supplier No. NBP23053625UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 2 publications

B7-H4 Polyclonal specifically detects B7-H4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen B7-H4
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q7Z7D3
Gene Alias B7h.5, B7-H4, B7H4T-cell costimulatory molecule B7x, B7S1VCTN1, B7XPRO1291, FLJ22418, Immune costimulatory protein B7-H4, Protein B7S1, T cell costimulatory molecule B7x, V-set domain containing T cell activation inhibitor 1, V-set domain-containing T-cell activation inhibitor 1
Gene Symbols VTCN1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 79679
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.