Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | beta-1,3-Glucuronyltransferase 1/B3GAT1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
beta-1,3-Glucuronyltransferase 1/B3GAT1 Polyclonal specifically detects beta-1,3-Glucuronyltransferase 1/B3GAT1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
beta-1,3-Glucuronyltransferase 1/B3GAT1 | |
Polyclonal | |
Rabbit | |
Cancer, Immunology | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
27087 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPPWSDTLPTI | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
Beta-1,3-glucuronyltransferase 1, beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P), EC 2.4.1.135, galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1, GlcAT-P, GLCATPGLCUATP, glcUAT-P, Glucuronosyltransferase P, NK1, NK-1, UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase | |
B3GAT1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title