Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. BLIMP1/PRDM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

BLIMP1/PRDM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. p-7233063 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB126651 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB126651 Supplier Novus Biologicals Supplier No. NBP310875100UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

BLIMP1/PRDM1 Polyclonal specifically detects BLIMP1/PRDM1 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen BLIMP1/PRDM1
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS buffer, 2% sucrose
Gene Alias Beta-interferon gene positive regulatory domain I-binding factor, beta-interferon gene positive-regulatory domain I binding factor, BLIMP-1, BLIMP1MGC118925, blmp-1, B-lymphocyte-induced maturation protein 1, MGC118922, MGC118923, Positive regulatory domain I-binding factor 1, PR domain containing 1, with ZNF domain, PR domain zinc finger protein 1, PR domain-containing protein 1, PRDI-BF1MGC118924, PRDI-binding factor 1, PRDI-binding factor-1, PR-domain zinc finger protein 1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BLIMP1/PRDM1 (NP_878911). Peptide sequence VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline B Cell Development and Differentiation Markers, Cancer, Chromatin Research, Cytokine Research, Diabetes Research, Immune System Diseases, Immunology, Innate Immunity, Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 639
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.