BLIMP1/PRDM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB126651	Novus Biologicals NBP310875100UL	100 μg

Description

BLIMP1/PRDM1 Polyclonal specifically detects BLIMP1/PRDM1 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: BLIMP1/PRDM1
• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: B Cell Development and Differentiation Markers, Cancer, Chromatin Research, Cytokine Research, Diabetes Research, Immune System Diseases, Immunology, Innate Immunity, Zinc Finger
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 639
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: Beta-interferon gene positive regulatory domain I-binding factor, beta-interferon gene positive-regulatory domain I binding factor, BLIMP-1, BLIMP1MGC118925, blmp-1, B-lymphocyte-induced maturation protein 1, MGC118922, MGC118923, Positive regulatory domain I-binding factor 1, PR domain containing 1, with ZNF domain, PR domain zinc finger protein 1, PR domain-containing protein 1, PRDI-BF1MGC118924, PRDI-binding factor 1, PRDI-binding factor-1, PR-domain zinc finger protein 1
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BLIMP1/PRDM1 (NP_878911). Peptide sequence VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES
• Purification Method: Affinity purified