BRUNOL6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB437107	Novus Biologicals NBP23205025UL	25 μL
NBP232050	Novus Biologicals NBP232050	0.1 mL

Description

BRUNOL6 Polyclonal specifically detects BRUNOL6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BRUNOL6
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Bruno (Drosophila) -like 6, RNA binding protein, Bruno -like 6, RNA binding protein, BRUNOL6bruno-like 6, RNA binding protein (Drosophila), bruno-like 6, RNA binding protein, Bruno-like protein 6, CELF-6, CUG-BP and ETR-3 like factor 6, CUG-BP- and ETR-3-like factor 6, CUGBP Elav-like family member 6, CUGBP, Elav-like family member 6, RNA-binding protein BRUNOL-6
• Gene Symbols: CELF6
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q96J87
• Gene ID (Entrez): 60677
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TLPGLPAPIGVNGFGPLTPQTNGQPGSDTLYNNGLS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only