Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
c-jun Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
| Antigen | Jun |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
c-jun Polyclonal specifically detects c-jun in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Jun | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Cell Cycle and Replication, Hypoxia, Immunology, Innate Immunity, Signal Transduction, Transcription Factors and Regulators, Tumor Suppressors, Wnt Signaling Pathway | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 3725 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Activator protein 1, AP1, AP-1, c-Jun, enhancer-binding protein AP1, Jun activation domain binding protein, jun oncogene, jun proto-oncogene, Proto-oncogene c-Jun, transcription factor AP-1, V-jun avian sarcoma virus 17 oncogene homologp39, v-jun sarcoma virus 17 oncogene homolog, v-jun sarcoma virus 17 oncogene homolog (avian) | |
| JUN | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title