C19orf73 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179663

Catalog No. NBP179663

Description

C19orf73 Polyclonal specifically detects C19orf73 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C19orf73
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: chromosome 19 open reading frame 73, FLJ10490, putative uncharacterized protein C19orf73
• Host Species: Rabbit
• Molecular Weight of Antigen: 14 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_060581
• Gene Symbols: C19ORF73
• Immunogen: Synthetic peptide directed towards the middle region of human FLJ10490. Peptide sequence VVRPAGFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55150
• Target Species: Human
• Isotype: IgG