Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C1D Antibody, Novus Biologicals™
SDP

Catalog No. NB433899 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB433899 25ul
NBP181287 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB433899 Supplier Novus Biologicals Supplier No. NBP18128725UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

C1D Polyclonal specifically detects C1D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen C1D
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias C1D DNA-binding protein, C1D nuclear receptor corepressor, C1D nuclear receptor co-repressor, hC1D, MGC12261, MGC14659, nuclear DNA-binding protein, nuclear nucleic acid-binding protein C1D, small unique nuclear receptor corepressor, small unique nuclear receptor co-repressor, SUN-CoR, SUNCORLRP1
Gene Symbols C1D
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMF
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 10438
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.