Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C1orf216 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16916520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16916520 20 μL
NBP169165 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16916520 Supplier Novus Biologicals Supplier No. NBP16916520UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

C1orf216 Polyclonal specifically detects C1orf216 in Human samples. It is validated for Western Blot.

Specifications

Antigen C1orf216
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8TAB5
Gene Alias chromosome 1 open reading frame 216, FLJ38984, hypothetical protein LOC127703
Gene Symbols C1ORF216
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C1orf216 (chromosome 1 open reading frame 216) The peptide sequence was selected from the N terminal of C1orf216. Peptide sequence GRVEPILRRSSSESPSDNQAFQAPGSPEEGVRSPPEGAEIPGAEPEKMGG.
Molecular Weight of Antigen 25 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 127703
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.