Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C1orf216 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16916520UL
Description
C1orf216 Polyclonal specifically detects C1orf216 in Human samples. It is validated for Western Blot.Specifications
| C1orf216 | |
| Polyclonal | |
| Western Blot 0.2-1 ug/ml | |
| Q8TAB5 | |
| C1ORF216 | |
| Synthetic peptides corresponding to C1orf216 (chromosome 1 open reading frame 216) The peptide sequence was selected from the N terminal of C1orf216. Peptide sequence GRVEPILRRSSSESPSDNQAFQAPGSPEEGVRSPPEGAEIPGAEPEKMGG. | |
| Affinity Purified | |
| RUO | |
| 127703 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 1 open reading frame 216, FLJ38984, hypothetical protein LOC127703 | |
| Rabbit | |
| 25 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction